• Gene id: 3775

Gene Summary

• Gene Symbol: KCNK1   Gene   UCSC   Ensembl
• Aliases: DPK, HOHO, K2P1, K2p1.1, KCNO1, TWIK-1, TWIK1
• Gene name: potassium two pore domain channel subfamily K member 1
• Alternate names: potassium channel subfamily K member 1, inward rectifying potassium channel protein TWIK-1, potassium channel K2P1, potassium channel KCNO1, potassium channel, two pore domain subfamily K, member 1, potassium inwardly-rectifying channel, subfamily K, member 1, ,
• Gene location: 1q42.2 (233614105: 233672513)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins fo

Protein Summary

• Protein general information: O00180  
  • Name: Potassium channel subfamily K member 1 (Inward rectifying potassium channel protein TWIK 1) (Potassium channel K2P1) (Potassium channel KCNO1)
  • Length: 336  
  • Mass: 38143
  • Tissue specificity: Detected in bronchial epithelial cells (PubMed
• Sequence:

  MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQL
  EQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLT
  AVVQRITVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLST
  IGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS
  FSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH

• Structural information:
  • Interpro: IPR003280  IPR003092  IPR005408  IPR001779  IPR013099  
  • PDB: 3UKM
  • PDBsum: 3UKM
  • DIP: 59532
  • STRING: ENSP00000355580
• Other Databases: GeneCards:  KCNK1  Malacards:  KCNK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0034705	potassium channel complex	IDA	cellular component
GO:0005267	potassium channel activity	IDA	molecular function
GO:0005272	sodium channel activity	IDA	molecular function
GO:0035725	sodium ion transmembrane transport	IDA	biological process
GO:0022841	potassium ion leak channel activity	IDA	molecular function
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005249	voltage-gated potassium channel activity	IDA	NOT|molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0060075	regulation of resting membrane potential	IMP	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0005242	inward rectifier potassium channel activity	TAS	molecular function
GO:0006813	potassium ion transport	TAS	biological process
GO:0008076	voltage-gated potassium channel complex	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0061337	cardiac conduction	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0022841	potassium ion leak channel activity	IEA	molecular function
GO:1902937	inward rectifier potassium channel complex	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0031526	brush border membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0097060	synaptic membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq