• Gene id: 3773

Gene Summary

• Gene Symbol: KCNJ16   Gene   UCSC   Ensembl
• Aliases: BIR9, KIR5.1
• Gene name: potassium inwardly rectifying channel subfamily J member 16
• Alternate names: inward rectifier potassium channel 16, inward rectifier K(+) channel Kir5.1, inward rectifier K+ channel KIR5.1, potassium channel, inwardly rectifying subfamily J member 16, potassium voltage-gated channel subfamily J member 16,
• Gene location: 17q24.3 (70075224: 70135607)     Exons: 10     NC_000017.11
• Gene summary(Entrez): Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, whi
• OMIM: 605722

Protein Summary

• Protein general information: Q9NPI9  
  • Name: Inward rectifier potassium channel 16 (Inward rectifier K(+) channel Kir5.1) (Potassium channel, inwardly rectifying subfamily J member 16)
  • Length: 418  
  • Mass: 47949
  • Tissue specificity: Widely expressed, with highest levels in adult and fetal kidney (at protein level). In the kidney, expressed in the proximal and distal convoluted tubules, but not in glomeruli nor collecting ducts. {ECO
• Sequence:

  MSYYGSSYHIINADAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKWRHMFV
  IFSLSYILSWLIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTGAFLFSLETQTTIGYGYRCVTEECSVAVLMV
  ILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTE
  DSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
  PREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVRESCTSDTKARRRSFS
  AVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM

• Structural information:
  • Interpro: IPR014756  IPR041647  IPR016449  IPR008061  IPR013518   IPR040445  
  • STRING: ENSP00000465295
• Other Databases: GeneCards:  KCNJ16  Malacards:  KCNJ16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005242	inward rectifier potassium channel activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0034765	regulation of ion transmembrane transport	IBA	biological process
GO:1990573	potassium ion import across plasma membrane	IBA	biological process
GO:0005242	inward rectifier potassium channel activity	IEA	molecular function
GO:0006813	potassium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0006813	potassium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008076	voltage-gated potassium channel complex	NAS	cellular component
GO:0006813	potassium ion transport	NAS	biological process
GO:0005242	inward rectifier potassium channel activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04971	Gastric acid secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)