• Gene id: 3772

Gene Summary

• Gene Symbol: KCNJ15   Gene   UCSC   Ensembl
• Aliases: IRKK, KIR1.3, KIR4.2
• Gene name: potassium inwardly rectifying channel subfamily J member 15
• Alternate names: ATP-sensitive inward rectifier potassium channel 15, inward rectifier K(+) channel Kir1.3, inward rectifier K(+) channel Kir4.2, inward rectifier K+ channel KIR4.2, potassium channel, inwardly rectifying subfamily J member 15, potassium voltage-gated channel s,
• Gene location: 21q22.13-q22.2 (38229925: 38307356)     Exons: 8     NC_000021.9
• Gene summary(Entrez): Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has
• OMIM: 602106

Protein Summary

• Protein general information: Q99712  
  • Name: ATP sensitive inward rectifier potassium channel 15 (Inward rectifier K(+) channel Kir1.3) (Inward rectifier K(+) channel Kir4.2) (Potassium channel, inwardly rectifying subfamily J member 15)
  • Length: 375  
  • Mass: 42577
• Sequence:

  MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFV
  MTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLLVAQL
  VITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEG
  ERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
  IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTLLLQQSNV

• Structural information:
  • Interpro: IPR014756  IPR041647  IPR016449  IPR003270  IPR013518   IPR040445  
  • STRING: ENSP00000331698
• Other Databases: GeneCards:  KCNJ15  Malacards:  KCNJ15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005242	inward rectifier potassium channel activity	IBA	molecular function
GO:1990573	potassium ion import across plasma membrane	IBA	biological process
GO:0034765	regulation of ion transmembrane transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005242	inward rectifier potassium channel activity	IEA	molecular function
GO:0006813	potassium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0005242	inward rectifier potassium channel activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006813	potassium ion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005242	inward rectifier potassium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04971	Gastric acid secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)