• Gene id: 376497

Gene Summary

• Gene Symbol: SLC27A1   Gene   UCSC   Ensembl
• Aliases: ACSVL5, FATP, FATP-1, FATP1
• Gene name: solute carrier family 27 member 1
• Alternate names: long-chain fatty acid transport protein 1, fatty acid transport protein 1, solute carrier family 27 (fatty acid transporter), member 1,
• Gene location: 19p13.11 (17468744: 17506168)     Exons: 16     NC_000019.10
• OMIM: 600691

Protein Summary

• Protein general information: Q6PCB7  
  • Name: Long chain fatty acid transport protein 1 (FATP 1) (Fatty acid transport protein 1) (EC 6.2.1. ) (Solute carrier family 27 member 1)
  • Length: 646  
  • Mass: 71108
  • Tissue specificity: Highest levels of expression are detected in muscle and adipose tissue small, intermediate levels in small intestine, and barely detectable in liver. {ECO
• Sequence:

  MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSVLIRVRLELRRHQRAG
  HTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPEFVGLWLGLAK
  AGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGKSLIKFCSGDLGPEGILPDTHLLDPLLK
  EASTAPLAQIPSKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIG
  VGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVREAERRHRVRLAVGNGLRPAIWEEFT
  ERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIRLVKVNEDTMELLRDAQGLCIPCQAGEPGLL
  VGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVE
  GVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQ
  KTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL

• Structural information:
  • Interpro: IPR025110  IPR020845  IPR000873  IPR042099  IPR030308  
  • Prosite: PS00455
  • STRING: ENSP00000252595
• Other Databases: GeneCards:  SLC27A1  Malacards:  SLC27A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0140115	export across plasma membrane	IDA	biological process
GO:0140115	export across plasma membrane	IDA	biological process
GO:1905135	biotin import across plasma membrane	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005324	long-chain fatty acid transporter activity	IDA	molecular function
GO:0005324	long-chain fatty acid transporter activity	IDA	molecular function
GO:0015562	efflux transmembrane transporter activity	IDA	molecular function
GO:0015562	efflux transmembrane transporter activity	IDA	molecular function
GO:0015225	biotin transmembrane transporter activity	IDA	molecular function
GO:0015225	biotin transmembrane transporter activity	IDA	molecular function
GO:0005324	long-chain fatty acid transporter activity	IMP	molecular function
GO:0005324	long-chain fatty acid transporter activity	IMP	molecular function
GO:0005324	long-chain fatty acid transporter activity	IMP	molecular function
GO:0015911	long-chain fatty acid import across plasma membrane	IDA	biological process
GO:0015878	biotin transport	IDA	biological process
GO:0015909	long-chain fatty acid transport	IDA	biological process
GO:0015562	efflux transmembrane transporter activity	IMP	molecular function
GO:1990379	lipid transport across blood-brain barrier	IMP	biological process
GO:0140115	export across plasma membrane	IMP	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0015911	long-chain fatty acid import across plasma membrane	IMP	biological process
GO:0009925	basal plasma membrane	ISS	cellular component
GO:0015909	long-chain fatty acid transport	IMP	biological process
GO:0015909	long-chain fatty acid transport	IMP	biological process
GO:0071072	negative regulation of phospholipid biosynthetic process	IBA	biological process
GO:0044539	long-chain fatty acid import into cell	IBA	biological process
GO:0032868	response to insulin	IBA	biological process
GO:0032049	cardiolipin biosynthetic process	IBA	biological process
GO:0006656	phosphatidylcholine biosynthetic process	IBA	biological process
GO:0006654	phosphatidic acid biosynthetic process	IBA	biological process
GO:0006646	phosphatidylethanolamine biosynthetic process	IBA	biological process
GO:0001579	medium-chain fatty acid transport	IBA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IBA	biological process
GO:0033211	adiponectin-activated signaling pathway	IBA	biological process
GO:0031652	positive regulation of heat generation	IBA	biological process
GO:0015245	fatty acid transmembrane transporter activity	IBA	molecular function
GO:0009409	response to cold	IBA	biological process
GO:0006661	phosphatidylinositol biosynthetic process	IBA	biological process
GO:0006659	phosphatidylserine biosynthetic process	IBA	biological process
GO:0006655	phosphatidylglycerol biosynthetic process	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005743	mitochondrial inner membrane	IBA	colocalizes with
GO:0005739	mitochondrion	IBA	cellular component
GO:0005324	long-chain fatty acid transporter activity	IBA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IBA	molecular function
GO:0044539	long-chain fatty acid import into cell	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	ISS	molecular function
GO:0010867	positive regulation of triglyceride biosynthetic process	ISS	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0015245	fatty acid transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031957	very long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0047676	arachidonate-CoA ligase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015909	long-chain fatty acid transport	TAS	biological process
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0033211	adiponectin-activated signaling pathway	IEA	biological process
GO:0031957	very long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0031652	positive regulation of heat generation	IEA	biological process
GO:0015909	long-chain fatty acid transport	IEA	biological process
GO:0015245	fatty acid transmembrane transporter activity	IEA	molecular function
GO:0010867	positive regulation of triglyceride biosynthetic process	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0044539	long-chain fatty acid import into cell	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0015908	fatty acid transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0001579	medium-chain fatty acid transport	IEA	biological process
GO:0012505	endomembrane system	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0006661	phosphatidylinositol biosynthetic process	IMP	biological process
GO:0006659	phosphatidylserine biosynthetic process	IMP	biological process
GO:0071072	negative regulation of phospholipid biosynthetic process	IMP	biological process
GO:0006656	phosphatidylcholine biosynthetic process	IMP	biological process
GO:0006655	phosphatidylglycerol biosynthetic process	IMP	biological process
GO:0032049	cardiolipin biosynthetic process	IMP	biological process
GO:0006654	phosphatidic acid biosynthetic process	IMP	biological process
GO:0006646	phosphatidylethanolamine biosynthetic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04931	Insulin resistance
hsa03320	PPAR signaling pathway
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray