• Gene id: 376267

Gene Summary

• Gene Symbol: RAB15   Gene   UCSC   Ensembl
• Gene name: RAB15, member RAS oncogene family
• Alternate names: ras-related protein Rab-15, RAB15, member RAS onocogene family, Ras-related protein Rab-15 isoform AN1, Ras-related protein Rab-15 isoform AN2, Ras-related protein Rab-15 isoform AN3,
• Gene location: 14q23.3 (64972335: 64945815)     Exons: 8     NC_000014.9

Protein Summary

• Protein general information: P59190  
  • Name: Ras related protein Rab 15
  • Length: 212  
  • Mass: 24391
• Sequence:

  MAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITK
  QYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVGREQGQQLAKEYGMDFYET
  SACTNLNIKESFTRLTELVLQAHRKELEGLRMRASNELALAELEEEEGKPEGPANSSKTCWC

• Structural information:
  • Interpro: IPR027417  IPR041826  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd04117
• Other Databases: GeneCards:  RAB15  Malacards:  RAB15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0017157	regulation of exocytosis	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0009306	protein secretion	IBA	biological process
GO:0006904	vesicle docking involved in exocytosis	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0032482	Rab protein signal transduction	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005929	cilium	IDA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:1903307	positive regulation of regulated secretory pathway	IGI	biological process
GO:1903307	positive regulation of regulated secretory pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq