• Gene id: 375686

Gene Summary

• Gene Symbol: SPATC1   Gene   UCSC   Ensembl
• Aliases: SPATA15
• Gene name: spermatogenesis and centriole associated 1
• Alternate names: speriolin, spermatogenesis and centriole-associated protein 1, spermatogenesis-associated protein 15, spermatogenic cell-specific Cdc20-binding protein, testicular tissue protein Li 181,
• Gene location: 8q24.3 (144010991: 144047113)     Exons: 6     NC_000008.11
• OMIM: 610874

Protein Summary

• Protein general information: Q76KD6  
  • Name: Speriolin (Spermatogenesis and centriole associated protein 1) (Spermatogenesis associated protein 15) (Spermatogenic cell specific Cdc20 binding protein)
  • Length: 591  
  • Mass: 62399
  • Tissue specificity: Detected only in testis. {ECO
• Sequence:

  MSLLTNYEGLRHQIERLVRENEELKKLVRLIRENHELKSAIKTQAGGLGISGFTSGLGEATAGLSSRQNNGVFLP
  PSPAVANERVLEEVGIMALAPLAEMLTSLQPSATPGSLMSPLTGTLSTLLSGPAPTSQSSPLTSFLTSPIAGPLT
  GTLASSLGLPSTGTLTPSSLVAGPVAMSQSSPLIAPVMGTVAVSLSSPLLSSTATPPGVSQNLLANPMSNLVLPE
  APRLRLAEPLRGGPTGPQSPACVVPTATTKVPLSTEPPQSTQDPEPLSMAFAGAPLQTSTPIGAMGTPAPKTAFS
  FNTSDTQAQPSAAQEQVVPASVPTSPTTSPTVTVLASAPALAPQVATSYTPSSTTHIAQGAPHPPSRMHNSPTQN
  LPVPHCPPHNAHSPPRTSSSPASVNDSRGPRTTEPSTKSMMEVERKLAHRKTSKFPENPRESKQLAWERLVGEIA
  FQLDRRILSSIFPERVRLYGFTVSNIPEKIIQASLNPSDHKLDEKLCQRLTQRYVSVMNRLQSLGYNGRVHPALT
  EQLVNAYGILRERPELAASEGGPYTVDFLQRVVVETVHPGMLADALLLLSCLSQLAHDDGKPMFIW

• Structural information:
  • Interpro: IPR026715  IPR029384  IPR029385  
  • STRING: ENSP00000366690
• Other Databases: GeneCards:  SPATC1  Malacards:  SPATC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IBA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq