• Gene id: 3755

Gene Summary

• Gene Symbol: KCNG1   Gene   UCSC   Ensembl
• Aliases: K13, KCNG, KV6.1, kH2
• Gene name: potassium voltage-gated channel modifier subfamily G member 1
• Alternate names: potassium voltage-gated channel subfamily G member 1, potassium channel KH2, potassium channel Kv6.1, potassium channel, voltage gated modifier subfamily G, member 1, potassium voltage-gated channel, subfamily G, member 1, voltage-gated potassium channel subun,
• Gene location: 20q13.13 (51023175: 51003655)     Exons: 5     NC_000020.11
• Gene summary(Entrez): Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro
• OMIM: 603788

Protein Summary

• Protein general information: Q9UIX4  
  • Name: Potassium voltage gated channel subfamily G member 1 (Voltage gated potassium channel subunit Kv6.1) (kH2)
  • Length: 513  
  • Mass: 57913
  • Tissue specificity: Expressed in brain and placenta, and at much lower levels in kidney and pancreas (PubMed
• Sequence:

  MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPEDRRRRIIINVGGIKYS
  LPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEE
  LLYWGIAEDHLDGCCKRRYLQKIEEFAEMVEREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERPHSGLP
  GKVFACLSVLFVTVTAVNLSVSTLPSLREEEEQGHCSQMCHNVFIVESVCVGWFSLEFLLRLIQAPSKFAFLRSP
  LTLIDLVAILPYYITLLVDGAAAGRRKPGAGNSYLDKVGLVLRVLRALRILYVMRLARHSLGLQTLGLTARRCTR
  EFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVITMTTVGYGDMVPRSTPGQVVALSSILSGIL
  LMAFPVTSIFHTFSRSYLELKQEQERVMFRRAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN

• Structural information:
  • Interpro: IPR000210  IPR005821  IPR003968  IPR003969  IPR011333   IPR003131  IPR028325  IPR027359  
  • STRING: ENSP00000360626
• Other Databases: GeneCards:  KCNG1  Malacards:  KCNG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0005251	delayed rectifier potassium channel activity	IBA	molecular function
GO:1902259	regulation of delayed rectifier potassium channel activity	IBA	biological process
GO:0005251	delayed rectifier potassium channel activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0008076	voltage-gated potassium channel complex	IDA	colocalizes with
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0005251	delayed rectifier potassium channel activity	ISS	molecular function
GO:1902259	regulation of delayed rectifier potassium channel activity	ISS	biological process
GO:0008076	voltage-gated potassium channel complex	ISS	colocalizes with
GO:0005886	plasma membrane	ISS	cellular component
GO:0071805	potassium ion transmembrane transport	ISS	biological process
GO:0005216	ion channel activity	IEA	molecular function
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:1902259	regulation of delayed rectifier potassium channel activity	IEA	biological process
GO:0005251	delayed rectifier potassium channel activity	IEA	molecular function
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006813	potassium ion transport	NAS	biological process
GO:0005267	potassium channel activity	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq