• Gene id: 375387

Gene Summary

• Gene Symbol: NRROS   Gene   UCSC   Ensembl
• Aliases: ELLP3030, GARPL1, LRRC33, SENEBAC, UNQ3030
• Gene name: negative regulator of reactive oxygen species
• Alternate names: transforming growth factor beta activator LRRC33, leucine-rich repeat-containing protein 33,
• Gene location: 3q29 (196639693: 196662003)     Exons: 3     NC_000003.12

Protein Summary

• Protein general information: Q86YC3  
  • Name: Transforming growth factor beta activator LRRC33 (Leucine rich repeat containing protein 33) (Negative regulator of reactive oxygen species)
  • Length: 692  
  • Mass: 76366
  • Tissue specificity: Mainly expressed in cells of hematopoietic origin (PubMed
• Sequence:

  MELLPLWLCLGFHFLTVGWRNRSGTATAASQGVCKLVGGAADCRGQSLASVPSSLPPHARMLTLDANPLKTLWNH
  SLQPYPLLESLSLHSCHLERISRGAFQEQGHLRSLVLGDNCLSENYEETAAALHALPGLRRLDLSGNALTEDMAA
  LMLQNLSSLRSVSLAGNTIMRLDDSVFEGLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGL
  TRLRVLNVSYNVLEWFLATGGEAAFELETLDLSHNQLLFFPLLPQYSKLRTLLLRDNNMGFYRDLYNTSSPREMV
  AQFLLVDGNVTNITTVSLWEEFSSSDLADLRFLDMSQNQFQYLPDGFLRKMPSLSHLNLHQNCLMTLHIREHEPP
  GALTELDLSHNQLSELHLAPGLASCLGSLRLFNLSSNQLLGVPPGLFANARNITTLDMSHNQISLCPLPAASDRV
  GPPSCVDFRNMASLRSLSLEGCGLGALPDCPFQGTSLTYLDLSSNWGVLNGSLAPLQDVAPMLQVLSLRNMGLHS
  SFMALDFSGFGNLRDLDLSGNCLTTFPRFGGSLALETLDLRRNSLTALPQKAVSEQLSRGLRTIYLSQNPYDCCG
  VDGWGALQHGQTVADWAMVTCNLSSKIIRVTELPGGVPRDCKWERLDLGLLYLVLILPSCLTLLVACTVIVLTFK
  KPLLQVIKSRCHWSSVY

• Structural information:
  • Protein Domains: (29..5-)
    (/note="LRRNT-)
    (/evidence="ECO:0000255-)
    (595..64-)
    (/note="LRRCT-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000328625
• Other Databases: GeneCards:  NRROS  Malacards:  NRROS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006955	immune response	IBA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0006801	superoxide metabolic process	ISS	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0050431	transforming growth factor beta binding	IPI	molecular function
GO:0045087	innate immune response	ISS	NOT|biological process
GO:0014005	microglia development	ISS	biological process
GO:0006801	superoxide metabolic process	ISS	NOT|biological process
GO:0006955	immune response	ISS	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0035583	sequestering of TGFbeta in extracellular matrix	ISS	biological process
GO:0036364	transforming growth factor beta1 activation	ISS	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	ISS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019838	growth factor binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0050431	transforming growth factor beta binding	IEA	molecular function
GO:0014005	microglia development	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0036364	transforming growth factor beta1 activation	IEA	biological process
GO:0035583	sequestering of TGFbeta in extracellular matrix	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007179	transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881