• Gene id: 375346

Gene Summary

• Gene Symbol: STIMATE   Gene   UCSC   Ensembl
• Aliases: TMEM110
• Gene name: STIM activating enhancer
• Alternate names: store-operated calcium entry regulator STIMATE, STIM-activating enhancer encoded by TMEM110, transmembrane protein 110,
• Gene location: 3p21.1 (52897547: 52836732)     Exons: 4     NC_000003.12
• OMIM: 617189

Protein Summary

• Protein general information: Q86TL2  
  • Name: Store operated calcium entry regulator STIMATE (STIM activating enhancer encoded by TMEM110) (Transmembrane protein 110)
  • Length: 294  
  • Mass: 33187
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFSTLMLKRFREPKHERRPWRIWFLDTS
  KQAIGMLFIHFANVYLADLTEEDPCSLYLINFLLDATVGMLLIYVGVRAVSVLVEWQQWESLRFGEYGDPLQCGA
  WVGQCALYIVIMIFEKSVVFIVLLILQWKKVALLNPIENPDLKLAIVMLIVPFFVNALMFWVVDNFLMRKGKTKA
  KLEERGANQDSRNGSKVRYRRAASHEESESEILISADDEMEESDVEEDLRRLTPLKPVKKKKHRFGLPV

• Structural information:
  • Interpro: IPR022127  
  • STRING: ENSP00000422941
• Other Databases: GeneCards:  STIMATE  Malacards:  STIMATE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035584	calcium-mediated signaling using intracellular calcium source	IBA	biological process
GO:0032237	activation of store-operated calcium channel activity	IBA	biological process
GO:0005246	calcium channel regulator activity	IBA	molecular function
GO:0032541	cortical endoplasmic reticulum	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0032237	activation of store-operated calcium channel activity	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005246	calcium channel regulator activity	IDA	molecular function
GO:0140268	endoplasmic reticulum-plasma membrane contact site	IDA	cellular component
GO:0035584	calcium-mediated signaling using intracellular calcium source	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005246	calcium channel regulator activity	IDA	molecular function
GO:0032237	activation of store-operated calcium channel activity	IDA	biological process
GO:0032541	cortical endoplasmic reticulum	IDA	cellular component
GO:0032541	cortical endoplasmic reticulum	IDA	cellular component
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881