• Gene id: 3751

Gene Summary

• Gene Symbol: KCND2   Gene   UCSC   Ensembl
• Aliases: KV4.2, RK5
• Gene name: potassium voltage-gated channel subfamily D member 2
• Alternate names: potassium voltage-gated channel subfamily D member 2, potassium channel, voltage gated Shal related subfamily D, member 2, voltage-gated potassium channel subunit Kv4.2, voltage-sensitive potassium channel,
• Gene location: 7q31.31 (120273174: 120750336)     Exons: 7     NC_000007.14
• Gene summary(Entrez): Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro
• OMIM: 605410

Protein Summary

• Protein general information: Q9NZV8  
  • Name: Potassium voltage gated channel subfamily D member 2 (Voltage gated potassium channel subunit Kv4.2)
  • Length: 630  
  • Mass: 70537
  • Tissue specificity: Detected in ovary, in corpus luteum and in granulosa and theca cells in the follicle (at protein level) (PubMed
• Sequence:

  MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLERYPDTLLGSSERDFF
  YHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIPEIIGDCCYEEYKDRRRENAERLQD
  DADTDTAGESALPTMTARQRVWRAFENPHTSTMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERY
  AVAFFCLDTACVMIFTVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
  FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAAFWYTIVTMTTLGYGD
  MVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRAQKKARLARIRAAKSGSANAYMQSKRN
  GLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGV
  TSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI
  PTPPVTTPEGDDRPESPEYSGGNIVRVSAL

• Structural information:
  • Interpro: IPR000210  IPR005821  IPR003968  IPR003975  IPR004055   IPR024587  IPR021645  IPR011333  IPR003131  IPR028325  IPR027359  
  • STRING: ENSP00000333496
• Other Databases: GeneCards:  KCND2  Malacards:  KCND2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005250	A-type (transient outward) potassium channel activity	IBA	molecular function
GO:1905030	voltage-gated ion channel activity involved in regulation of postsynaptic membrane potential	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0043197	dendritic spine	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005249	voltage-gated potassium channel activity	IDA	molecular function
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0071456	cellular response to hypoxia	ISS	biological process
GO:0005250	A-type (transient outward) potassium channel activity	ISS	molecular function
GO:0045211	postsynaptic membrane	ISS	cellular component
GO:0044853	plasma membrane raft	ISS	cellular component
GO:0043197	dendritic spine	ISS	cellular component
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0005249	voltage-gated potassium channel activity	ISS	molecular function
GO:0005250	A-type (transient outward) potassium channel activity	IMP	molecular function
GO:0031226	intrinsic component of plasma membrane	IMP	cellular component
GO:0005216	ion channel activity	IEA	molecular function
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0061337	cardiac conduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1905030	voltage-gated ion channel activity involved in regulation of postsynaptic membrane potential	IEA	molecular function
GO:0099060	integral component of postsynaptic specialization membrane	IEA	cellular component
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0019233	sensory perception of pain	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0045475	locomotor rhythm	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0019228	neuronal action potential	IEA	biological process
GO:0005250	A-type (transient outward) potassium channel activity	IEA	molecular function
GO:0001508	action potential	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005249	voltage-gated potassium channel activity	NAS	molecular function
GO:0001508	action potential	TAS	biological process
GO:0043197	dendritic spine	NAS	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04726	Serotonergic synapse

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R