• Gene id: 374969

Gene Summary

• Gene Symbol: SVBP   Gene   UCSC   Ensembl
• Aliases: CCDC23, NEDAHM
• Gene name: small vasohibin binding protein
• Alternate names: small vasohibin-binding protein, coiled-coil domain containing 23, coiled-coil domain-containing protein 23,
• Gene location: 1p34.2 (42817396: 42807051)     Exons: 3     NC_000001.11
• OMIM: 617853

Protein Summary

• Protein general information: Q8N300  
  • Name: Small vasohibin binding protein (Coiled coil domain containing protein 23)
  • Length: 66  
  • Mass: 7808
• Sequence:

  MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE

• Structural information:
  • Interpro: IPR031378  
  • PDB: 6J4O 6J4P 6J4Q 6J4S 6J4U 6J4V 6J7B 6J8F 6J8N 6J8O 6J91 6J9H 6JZC 6JZD 6JZE 6NVQ 6OCF 6OCG 6OCH 6QBY
  • PDBsum: 6J4O 6J4P 6J4Q 6J4S 6J4U 6J4V 6J7B 6J8F 6J8N 6J8O 6J91 6J9H 6JZC 6JZD 6JZE 6NVQ 6OCF 6OCG 6OCH 6QBY
  • STRING: ENSP00000361599
• Other Databases: GeneCards:  SVBP  Malacards:  SVBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031397	negative regulation of protein ubiquitination	IBA	biological process
GO:0045177	apical part of cell	IBA	cellular component
GO:0009306	protein secretion	IBA	biological process
GO:0008017	microtubule binding	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:1905048	regulation of metallopeptidase activity	IMP	biological process
GO:1905048	regulation of metallopeptidase activity	IMP	biological process
GO:1905048	regulation of metallopeptidase activity	IMP	biological process
GO:1905048	regulation of metallopeptidase activity	IMP	biological process
GO:0061564	axon development	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045177	apical part of cell	IDA	cellular component
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0009306	protein secretion	IDA	biological process
GO:0010596	negative regulation of endothelial cell migration	IGI	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)