• Gene id: 3749

Gene Summary

• Gene Symbol: KCNC4   Gene   UCSC   Ensembl
• Aliases: C1orf30, HKSHIIIC, KSHIIIC, KV3.4
• Gene name: potassium voltage-gated channel subfamily C member 4
• Alternate names: potassium voltage-gated channel subfamily C member 4, K+ channel subunit, potassium channel, voltage gated Shaw related subfamily C, member 4, potassium voltage-gated channel, Shaw-related subfamily, member 4, voltage-gated potassium channel subunit KV3.4,
• Gene location: 1p13.3 (110210313: 110282648)     Exons: 14     NC_000001.11
• Gene summary(Entrez): The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. The protein encoded by this gene belongs to the del
• OMIM: 176265

Protein Summary

• Protein general information: Q03721  
  • Name: Potassium voltage gated channel subfamily C member 4 (KSHIIIC) (Voltage gated potassium channel subunit Kv3.4)
  • Length: 635  
  • Mass: 69767
• Sequence:

  MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPE
  TDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQ
  HRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAA
  RVVAFASLFFILVSITTFCLETHEAFNIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRI
  VCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLR
  ASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM
  LVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRKKHVPRPAQLESPMYCKSEETSPRDSTCSDTSP
  PAREEGMIERKRADSKQNGDANAVLSDEEGAGLTQPLASSPTPEERRALRRSTTRDRNKKAAACFLLSTGDYACA
  DGSVRKGTFVLRDLPLQHSPEAACPPTAGTLFLPH

• Structural information:
  • Interpro: IPR000210  IPR005821  IPR003968  IPR003974  IPR005405   IPR021105  IPR011333  IPR003131  IPR028325  IPR027359  
  • PDB: 1B4G 1B4I 1ZTN
  • PDBsum: 1B4G 1B4I 1ZTN
  • STRING: ENSP00000358802
• Other Databases: GeneCards:  KCNC4  Malacards:  KCNC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005251	delayed rectifier potassium channel activity	IBA	molecular function
GO:0030424	axon	IBA	cellular component
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0032590	dendrite membrane	IBA	cellular component
GO:0032809	neuronal cell body membrane	IBA	cellular component
GO:0043025	neuronal cell body	IBA	cellular component
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0005216	ion channel activity	IEA	molecular function
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0005249	voltage-gated potassium channel activity	TAS	molecular function
GO:0005267	potassium channel activity	TAS	molecular function
GO:0008076	voltage-gated potassium channel complex	TAS	cellular component
GO:0006813	potassium ion transport	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046928	regulation of neurotransmitter secretion	IEA	biological process
GO:0043679	axon terminus	IEA	cellular component
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Alzheimer's disease	PMID:15485486
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq