• Gene id: 374875

Gene Summary

• Gene Symbol: HSD11B1L   Gene   UCSC   Ensembl
• Aliases: 11-DH3, 11-beta-HSD3, HSD1L, HSD3, SCDR10, SCDR10B, SDR26C2
• Gene name: hydroxysteroid 11-beta dehydrogenase 1 like
• Alternate names: hydroxysteroid 11-beta-dehydrogenase 1-like protein, 11-beta-hydroxysteroid dehydrogenase type 3, short chain dehydrogenase/reductase 10, short chain dehydrogenase/reductase family 26C member 2,
• Gene location: 19p13.3 (112976701: 113022194)     Exons: 12     NC_000005.10
• Gene summary(Entrez): This gene is a member of the hydroxysteroid dehydrogenase family. The encoded protein is similar to an enzyme that catalyzes the interconversion of inactive to active glucocorticoids (e.g. cortisone). Alternatively spliced transcript variants encoding mul

Protein Summary

• Protein general information: Q7Z5J1  
  • Name: Hydroxysteroid 11 beta dehydrogenase 1 like protein (EC 1.1.1. ) (11 beta hydroxysteroid dehydrogenase type 3) (11 DH3) (11 beta HSD3) (Short chain dehydrogenase/reductase family 26C member 2) (Short chain dehydrogenase/reductase 10)
  • Length: 315  
  • Mass: 34288
• Sequence:

  MKVLLLTGLGALFFAYYWDDNFDPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVVGNCRK
  LGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRAL
  PSLTDSKGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVAITMCVLGLRDRASAAEAVRSS
  TSRPRQPEHRGVPLQSQTAMFLPPTVPGARTLTETPLRGWPQPKMKSSRQKSKTEKNDGHLEPVTAWEVQVPRVR
  RLCRGLARPHLFGHD

• Structural information:
  • Interpro: IPR036291  IPR020904  IPR002347  
  • Prosite: PS00061
  • STRING: ENSP00000480443
• Other Databases: GeneCards:  HSD11B1L  Malacards:  HSD11B1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00140	Steroid hormone biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)