• Gene id: 3747

Gene Summary

• Gene Symbol: KCNC2   Gene   UCSC   Ensembl
• Aliases: KV3.2
• Gene name: potassium voltage-gated channel subfamily C member 2
• Alternate names: potassium voltage-gated channel subfamily C member 2, potassium channel, voltage gated Shaw related subfamily C, member 2, potassium voltage-gated channel, Shaw-related subfamily, member 2, shaw-like potassium channel, voltage-gated potassium channel Kv3.2,
• Gene location: 12q21.1 (75209838: 75040077)     Exons: 8     NC_000012.12
• Gene summary(Entrez): The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encode
• OMIM: 100730

Protein Summary

• Protein general information: Q96PR1  
  • Name: Potassium voltage gated channel subfamily C member 2 (Shaw like potassium channel) (Voltage gated potassium channel Kv3.2)
  • Length: 638  
  • Mass: 70226
• Sequence:

  MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPG
  GCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEP
  CCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSS
  RAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFLVR
  IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTL
  RASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSG
  MLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTC
  LGKDNRLLEHNRSVLSGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRS
  LNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL

• Structural information:
  • Interpro: IPR000210  IPR005821  IPR003968  IPR003974  IPR011333   IPR003131  IPR028325  IPR027359  
  • STRING: ENSP00000449253
• Other Databases: GeneCards:  KCNC2  Malacards:  KCNC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030424	axon	IBA	cellular component
GO:0005251	delayed rectifier potassium channel activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0043025	neuronal cell body	IBA	cellular component
GO:0032809	neuronal cell body membrane	IBA	cellular component
GO:0032590	dendrite membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0042734	presynaptic membrane	ISS	cellular component
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0005251	delayed rectifier potassium channel activity	ISS	molecular function
GO:0051291	protein heterooligomerization	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0045211	postsynaptic membrane	ISS	cellular component
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0071732	cellular response to nitric oxide	ISS	biological process
GO:0038060	nitric oxide-cGMP-mediated signaling pathway	ISS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0045202	synapse	ISS	cellular component
GO:0043204	perikaryon	ISS	cellular component
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0008076	voltage-gated potassium channel complex	ISS	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0005249	voltage-gated potassium channel activity	ISS	molecular function
GO:0071805	potassium ion transmembrane transport	ISS	biological process
GO:0051260	protein homooligomerization	ISS	biological process
GO:0043204	perikaryon	ISS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0005216	ion channel activity	IEA	molecular function
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050796	regulation of insulin secretion	TAS	biological process
GO:0099508	voltage-gated ion channel activity involved in regulation of presynaptic membrane potential	IEA	molecular function
GO:0097237	cellular response to toxic substance	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0071732	cellular response to nitric oxide	IEA	biological process
GO:0071242	cellular response to ammonium ion	IEA	biological process
GO:0051260	protein homooligomerization	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0038060	nitric oxide-cGMP-mediated signaling pathway	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0032809	neuronal cell body membrane	IEA	cellular component
GO:0032026	response to magnesium ion	IEA	biological process
GO:0031982	vesicle	IEA	cellular component
GO:0021759	globus pallidus development	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0014075	response to amine	IEA	biological process
GO:0009642	response to light intensity	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:1990089	response to nerve growth factor	IEA	biological process
GO:1903818	positive regulation of voltage-gated potassium channel activity	IEA	biological process
GO:1901381	positive regulation of potassium ion transmembrane transport	IEA	biological process
GO:0051291	protein heterooligomerization	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0044325	ion channel binding	IEA	molecular function
GO:0043195	terminal bouton	IEA	cellular component
GO:0030673	axolemma	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0005251	delayed rectifier potassium channel activity	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0099505	regulation of presynaptic membrane potential	IEA	biological process

Diseases

Associated diseases	References
Glioblastoma multiforme	PMID:18474104
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq