• Gene id: 3739

Gene Summary

• Gene Symbol: KCNA4   Gene   UCSC   Ensembl
• Aliases: HBK4, HK1, HPCN2, HUKII, KCNA4L, KCNA8, KV1.4, MCIDDS, PCN2
• Gene name: potassium voltage-gated channel subfamily A member 4
• Alternate names: potassium voltage-gated channel subfamily A member 4, cardiac potassium channel, fetal skeletal muscle potassium channel, potassium channel 2, potassium channel, voltage gated shaker related subfamily A, member 4, rapidly inactivating potassium channel, shaker-,
• Gene location: 11p14.1 (15379786: 15353384)     Exons: 14     NC_000019.10
• Gene summary(Entrez): Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, e
• OMIM: 176266

Protein Summary

• Protein general information: P22459  
  • Name: Potassium voltage gated channel subfamily A member 4 (HPCN2) (Voltage gated K(+) channel HuKII) (Voltage gated potassium channel HBK4) (Voltage gated potassium channel HK1) (Voltage gated potassium channel subunit Kv1.4)
  • Length: 653  
  • Mass: 73257
  • Tissue specificity: Expressed in brain, and at lower levels in the testis, lung, kidney, colon and heart (PubMed
• Sequence:

  MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGGSHHHHQSRGACTSHD
  PQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRELSEEEEDEEEEEEEEEEGRFYYSEDDHGDE
  CSYTDLLPQDEGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNR
  PSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYP
  ESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGLLNDTSAPHLENSGHTIFNDPFFIVE
  TVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAMSFAILRIIRLVR
  VFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTV
  GYGDMKPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSS
  TSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV

• Structural information:
  • Interpro: IPR000210  IPR005821  IPR003968  IPR003972  IPR020467   IPR012897  IPR037065  IPR011333  IPR003131  IPR028325  IPR027359  
  • STRING: ENSP00000328511
• Other Databases: GeneCards:  KCNA4  Malacards:  KCNA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005251	delayed rectifier potassium channel activity	IBA	molecular function
GO:0030424	axon	IBA	cellular component
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0043197	dendritic spine	IBA	cellular component
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0005249	voltage-gated potassium channel activity	IDA	molecular function
GO:0030424	axon	ISS	cellular component
GO:0016021	integral component of membrane	ISS	cellular component
GO:0008076	voltage-gated potassium channel complex	ISS	cellular component
GO:0008076	voltage-gated potassium channel complex	IMP	cellular component
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0005249	voltage-gated potassium channel activity	IMP	molecular function
GO:0071805	potassium ion transmembrane transport	IMP	biological process
GO:0030955	potassium ion binding	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005249	voltage-gated potassium channel activity	TAS	molecular function
GO:0006813	potassium ion transport	TAS	biological process
GO:0008076	voltage-gated potassium channel complex	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04934	Cushing syndrome
hsa04927	Cortisol synthesis and secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)