• Gene id: 3738

Gene Summary

• Gene Symbol: KCNA3   Gene   UCSC   Ensembl
• Aliases: HGK5, HLK3, HPCN3, HUKIII, KV1.3, MK3, PCN3
• Gene name: potassium voltage-gated channel subfamily A member 3
• Alternate names: potassium voltage-gated channel subfamily A member 3, potassium channel 3, potassium channel, voltage gated shaker related subfamily A, member 3, potassium voltage-gated channel, shaker-related subfamily, member 3, type n potassium channel, voltage-gated K(+) ,
• Gene location: 1p13.3 (110674939: 110653559)     Exons: 4     NC_000001.11
• Gene summary(Entrez): Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, e
• OMIM: 611158

Protein Summary

• Protein general information: P22001  
  • Name: Potassium voltage gated channel subfamily A member 3 (HGK5) (HLK3) (HPCN3) (Voltage gated K(+) channel HuKIII) (Voltage gated potassium channel subunit Kv1.3)
  • Length: 575  
  • Mass: 63842
• Sequence:

  MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGGGAPPQ
  GGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFD
  RNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFE
  YPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET
  LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIF
  KLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPTSGFSSIPDAFWWAVVTMTTVGYGDM
  HPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLS
  KSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV

• Structural information:
  • Interpro: IPR000210  IPR005821  IPR003968  IPR003972  IPR004050   IPR011333  IPR003131  IPR028325  IPR027359  
  • PDB: 4BGC
  • PDBsum: 4BGC
  • DIP: 44822
  • STRING: ENSP00000358784
• Other Databases: GeneCards:  KCNA3  Malacards:  KCNA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0005251	delayed rectifier potassium channel activity	IBA	molecular function
GO:0030424	axon	IBA	cellular component
GO:0005216	ion channel activity	IEA	molecular function
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	TAS	molecular function
GO:0006813	potassium ion transport	TAS	biological process
GO:0008076	voltage-gated potassium channel complex	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0044305	calyx of Held	IEA	cellular component
GO:0015271	outward rectifier potassium channel activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005251	delayed rectifier potassium channel activity	IEA	molecular function
GO:0030424	axon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq