• Gene id: 3737

Gene Summary

• Gene Symbol: KCNA2   Gene   UCSC   Ensembl
• Aliases: EIEE32, HBK5, HK4, HUKIV, KV1.2, MK2, NGK1, RBK2
• Gene name: potassium voltage-gated channel subfamily A member 2
• Alternate names: potassium voltage-gated channel subfamily A member 2, potassium channel, voltage gated shaker related subfamily A, member 2, potassium voltage-gated channel, shaker-related subfamily, member 2, voltage-gated K(+) channel HuKIV, voltage-gated potassium channel,
• Gene location: 1p13.3 (110631535: 110593579)     Exons: 9     NC_000001.11
• Gene summary(Entrez): Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, e
• OMIM: 120216

Protein Summary

• Protein general information: P16389  
  • Name: Potassium voltage gated channel subfamily A member 2 (NGK1) (Voltage gated K(+) channel HuKIV) (Voltage gated potassium channel HBK5) (Voltage gated potassium channel subunit Kv1.2)
  • Length: 499  
  • Mass: 56717
  • Tissue specificity: Detected in brain cortex (PubMed
• Sequence:

  MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNE
  YFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVW
  LLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIV
  ETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR
  VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTV
  GYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSA
  STISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV

• Structural information:
  • Interpro: IPR000210  IPR005821  IPR003968  IPR003972  IPR004049   IPR011333  IPR003131  IPR028325  IPR027359  
  • STRING: ENSP00000433109
• Other Databases: GeneCards:  KCNA2  Malacards:  KCNA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030425	dendrite	IBA	cellular component
GO:0005251	delayed rectifier potassium channel activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0044224	juxtaparanode region of axon	IBA	cellular component
GO:0043679	axon terminus	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0014059	regulation of dopamine secretion	ISS	biological process
GO:0005251	delayed rectifier potassium channel activity	ISS	molecular function
GO:0019228	neuronal action potential	ISS	biological process
GO:0043204	perikaryon	ISS	cellular component
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0005249	voltage-gated potassium channel activity	ISS	molecular function
GO:0071805	potassium ion transmembrane transport	ISS	biological process
GO:0030027	lamellipodium	ISS	cellular component
GO:0019233	sensory perception of pain	ISS	biological process
GO:0071805	potassium ion transmembrane transport	IMP	biological process
GO:0005249	voltage-gated potassium channel activity	IMP	molecular function
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0043679	axon terminus	ISS	cellular component
GO:0005216	ion channel activity	IEA	molecular function
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051260	protein homooligomerization	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005251	delayed rectifier potassium channel activity	TAS	molecular function
GO:0005267	potassium channel activity	TAS	molecular function
GO:0005249	voltage-gated potassium channel activity	TAS	molecular function
GO:0006813	potassium ion transport	TAS	biological process
GO:0008076	voltage-gated potassium channel complex	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0014059	regulation of dopamine secretion	IEA	biological process
GO:0021633	optic nerve structural organization	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005251	delayed rectifier potassium channel activity	IEA	molecular function
GO:0019228	neuronal action potential	IEA	biological process
GO:0034705	potassium channel complex	IEA	cellular component
GO:0097623	potassium ion export across plasma membrane	IEA	biological process
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0032809	neuronal cell body membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0043679	axon terminus	IEA	cellular component
GO:0044224	juxtaparanode region of axon	IEA	cellular component
GO:0045188	regulation of circadian sleep/wake cycle, non-REM sleep	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0015271	outward rectifier potassium channel activity	IEA	molecular function
GO:0019233	sensory perception of pain	IEA	biological process
GO:0019894	kinesin binding	IEA	molecular function
GO:0030027	lamellipodium	IEA	cellular component
GO:0044224	juxtaparanode region of axon	IEA	cellular component
GO:0044305	calyx of Held	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0044224	juxtaparanode region of axon	ISS	cellular component
GO:0044224	juxtaparanode region of axon	ISS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0033010	paranodal junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0031258	lamellipodium membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030424	axon	IEA	cellular component

Diseases

Associated diseases	References
Early infantile epileptic encephalopathy	KEGG:H00606
Early infantile epileptic encephalopathy	KEGG:H00606
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881