• Gene id: 373156

Gene Summary

• Gene Symbol: GSTK1   Gene   UCSC   Ensembl
• Aliases: GST, GST 13-13, GST13, GST13-13, GSTK1-1, hGSTK1
• Gene name: glutathione S-transferase kappa 1
• Alternate names: glutathione S-transferase kappa 1, GST class-kappa, glutathione S-transferase k1, glutathione S-transferase subunit 13 homolog,
• Gene location: 7q34 (143263428: 143269128)     Exons: 8     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range o
• OMIM: 602321

Protein Summary

• Protein general information: Q9Y2Q3  
  • Name: Glutathione S transferase kappa 1 (EC 2.5.1.18) (GST 13 13) (GST class kappa) (GSTK1 1) (hGSTK1) (Glutathione S transferase subunit 13)
  • Length: 226  
  • Mass: 25,497
• Sequence:

  MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRH
  HLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAE
  QAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNAR
  L

• Structural information:
  • Interpro: IPR001853  IPR014440  IPR036249  
  • PDB: 1YZX 3RPN 3RPP
  • PDBsum: 1YZX 3RPN 3RPP
  • DIP: 46924
• Other Databases: GeneCards:  GSTK1  Malacards:  GSTK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0006749	glutathione metabolic process	IEA	biological process
GO:0015035	protein disulfide oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0006749	glutathione metabolic process	IEA	biological process
GO:0015035	protein disulfide oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IDA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04146	Peroxisome
hsa05204	Chemical carcinogenesis

Diseases

Associated diseases	References
Diabetes	GAD: 19225211
Varicocele	MIK: 24472021
Male factor infertility	MIK: 26663067
Male factor infertility	MIK: 26027266
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 26027266
Varicocele	MIK: 24472021
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26663067	Idiopathic male infertility	SPO11 c.517C>T(rs28368082) and GST genes (GSTM1, GSTT1, GSTP1) polymorphisms	Han Chi nese	414 (216 idiopathic male infertility cases, 198 normal samples)	Male infertility
26027266	Male infertility			90 (60 men with infertility were examined--30 with normal weight and 30 with overweight), 30fertile men)	Male infertility	GSH GR GPO GST
24472021	Male infertility, varicocele			95 infertile oligoasthenoteratozoospemic (OAT) men associated with Varicocele	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881