• Gene id: 3727

Gene Summary

• Gene Symbol: JUND   Gene   UCSC   Ensembl
• Aliases: AP-1
• Gene name: JunD proto-oncogene, AP-1 transcription factor subunit
• Alternate names: transcription factor jun-D, JunD-FL isoform, activator protein 1, jun D proto-oncogene,
• Gene location: 19p13.11 (18281621: 18279693)     Exons: 1     NC_000019.10
• Gene summary(Entrez): The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative transla
• OMIM: 605597

Protein Summary

• Protein general information: P17535  
  • Name: Transcription factor jun D
  • Length: 347  
  • Mass: 35174
• Sequence:

  METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRA
  DGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQ
  NQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPP
  PPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
  KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY

• Structural information:
  • Protein Domains: (268..33-)
    (/note="bZIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00978"-)
  • Interpro: IPR004827  IPR005643  IPR029823  IPR002112  IPR008917  
  • Prosite: PS50217 PS00036
  • PDB: 3U86 5VPA 5VPB 5VPC 5VPD 5VPE 5VPF
  • PDBsum: 3U86 5VPA 5VPB 5VPC 5VPD 5VPE 5VPF
  • DIP: 1053
  • STRING: ENSP00000252818
• Other Databases: GeneCards:  JUND  Malacards:  JUND

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0045597	positive regulation of cell differentiation	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0034097	response to cytokine	IBA	biological process
GO:0010033	response to organic substance	IBA	biological process
GO:0009612	response to mechanical stimulus	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0051591	response to cAMP	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0042493	response to drug	IBA	biological process
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0009314	response to radiation	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000785	chromatin	TAS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006366	transcription by RNA polymerase II	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0032993	protein-DNA complex	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0045669	positive regulation of osteoblast differentiation	IEA	biological process
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0009416	response to light stimulus	IEA	biological process
GO:0016922	nuclear receptor binding	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0002076	osteoblast development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0008134	transcription factor binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0035976	transcription factor AP-1 complex	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04380	Osteoclast differentiation
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray