• Gene id: 3714

Gene Summary

• Gene Symbol: JAG2   Gene   UCSC   Ensembl
• Aliases: HJ2, SER2
• Gene name: jagged canonical Notch ligand 2
• Alternate names: protein jagged-2, jagged 2,
• Gene location: 14q32.33 (105168775: 105140980)     Exons: 26     NC_000014.9
• Gene summary(Entrez): The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded
• OMIM: 615647

Protein Summary

• Protein general information: Q9Y219  
  • Name: Protein jagged 2 (Jagged2) (hJ2)
  • Length: 1238  
  • Mass: 133367
  • Tissue specificity: Expressed in heart, placenta and skeletal muscle and to a lesser extent in pancreas. Very low expression in brain, lung, liver and kidney.
• Sequence:

  MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCL
  KEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWD
  WDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQ
  YGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWG
  GLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPS
  GWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCI
  PGWKGINCHINVNDCRGQCQHGGTCKDLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCP
  QGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGT
  AASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNP
  NDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAVA
  KNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCR
  INIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRD
  CSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHLDNNCARLTL
  HFNRDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSGASAVEVAVSFSPARDLPDSSLIQGAAHAIV
  AAITQRGNSSLLLAVTEVKVETVVTGGSSTGLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRLPREESAN
  NQWAPLNPIRNPIERPGGHKDVLYQCKNFTPPPRRADEALPGPAGHAAVREDEEDEDLGRGEEDSLEAEKFLSHK
  FTKDPGRSPGRPAHWASGPKVDNRAVRSINEARYAGKE

• Structural information:
  • Protein Domains: (196..24-)
    (/note="DSL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00377-)
    (241..27-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (275..30-)
    (/note="EGF-like-)
    (-)
    (/evidence="ECO:0000255|PROSITE-ProR-)
  • Interpro: IPR001774  IPR001881  IPR013032  IPR000742  IPR000152   IPR018097  IPR009030  IPR033108  IPR026219  IPR011651  IPR001007  
  • Prosite: PS00010 PS51051 PS00022 PS01186 PS50026 PS01187 PS50184
  • PDB: 5MW5 5MW7 5MWF
  • PDBsum: 5MW5 5MW7 5MWF
  • STRING: ENSP00000328169
• Other Databases: GeneCards:  JAG2  Malacards:  JAG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005112	Notch binding	IBA	molecular function
GO:0045746	negative regulation of Notch signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0045747	positive regulation of Notch signaling pathway	ISS	biological process
GO:0005112	Notch binding	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0007154	cell communication	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007219	Notch signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990134	epithelial cell apoptotic process involved in palatal shelf morphogenesis	IEA	biological process
GO:0045747	positive regulation of Notch signaling pathway	IEA	biological process
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0016331	morphogenesis of embryonic epithelium	IEA	biological process
GO:0005112	Notch binding	IEA	molecular function
GO:0003016	respiratory system process	IEA	biological process
GO:0001501	skeletal system development	IEA	biological process
GO:0042492	gamma-delta T cell differentiation	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009912	auditory receptor cell fate commitment	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0001701	in utero embryonic development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042127	regulation of cell population proliferation	IDA	biological process
GO:0030154	cell differentiation	IDA	biological process
GO:0045061	thymic T cell selection	IDA	biological process
GO:0030217	T cell differentiation	IDA	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0007283	spermatogenesis	IEP	biological process
GO:0007219	Notch signaling pathway	NAS	biological process
GO:0005112	Notch binding	IPI	molecular function
GO:0009912	auditory receptor cell fate commitment	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05224	Breast cancer
hsa04658	Th1 and Th2 cell differentiation
hsa01522	Endocrine resistance
hsa04330	Notch signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 26361204
Embryo quality	MIK: 26361204
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
26361204	Male infertility, Embryo quality			181 (127 men undergoing IVF treatment, 54 normozoospermic, fertile men)	Male infertility	Microarray