• Gene id: 3713

Gene Summary

• Gene Symbol: IVL   Gene   UCSC   Ensembl
• Gene name: involucrin
• Alternate names: involucrin,
• Gene location: 1q21.3 (152908544: 152911885)     Exons: 2     NC_000001.11
• Gene summary(Entrez): Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase. This gene is mapped to 1q21, among calpactin I light chain, trichohyalin, profillaggrin, loricrin, and c
• OMIM: 607282

Protein Summary

• Protein general information: P07476  
  • Name: Involucrin
  • Length: 585  
  • Mass: 68479
  • Tissue specificity: Keratinocytes of epidermis and other stratified squamous epithelia.
• Sequence:

  MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQEC
  EQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE
  QLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLEL
  PEQQEGQLELPQQQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQE
  KQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEGQLGLPEQQVLQLKQ
  LEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQVEHLEQQVGQLKHLEEQEGQLKHLEQQQGQL
  EVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQ
  QEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK

• Structural information:
  • Interpro: IPR019743  IPR019571  IPR000354  
  • Prosite: PS00795
  • PDB: 1EU0
  • PDBsum: 1EU0
  • STRING: ENSP00000357753
• Other Databases: GeneCards:  IVL  Malacards:  IVL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0031424	keratinization	IEA	biological process
GO:0031424	keratinization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001533	cornified envelope	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0070268	cornification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030216	keratinocyte differentiation	IDA	biological process
GO:0018149	peptide cross-linking	IDA	biological process
GO:0010224	response to UV-B	IDA	biological process
GO:0001533	cornified envelope	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0018153	isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine	TAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881