• Gene id: 3706

Gene Summary

• Gene Symbol: ITPKA   Gene   UCSC   Ensembl
• Aliases: IP3-3KA, IP3KA
• Gene name: inositol-trisphosphate 3-kinase A
• Alternate names: inositol-trisphosphate 3-kinase A, IP3 3-kinase A, IP3K A, inositol 1,4,5-trisphosphate 3-kinase A, insP 3-kinase A,
• Gene location: 15q15.1 (41493873: 41503554)     Exons: 8     NC_000015.10
• Gene summary(Entrez): Regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of the inositol 1,4,5-trisphosphate 3-kinase is responsible for regulating the levels of a large number of inositol
• OMIM: 601334

Protein Summary

• Protein general information: P23677  
  • Name: Inositol trisphosphate 3 kinase A (EC 2.7.1.127) (Inositol 1,4,5 trisphosphate 3 kinase A) (IP3 3 kinase A) (IP3K A) (InsP 3 kinase A)
  • Length: 461  
  • Mass: 51009
• Sequence:

  MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAKRRGGQVPNGLPRAPP
  APVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRLSTSSVSSTGSSSLLEDSEDDLLSDSESRSR
  GNVQLEAGEDVGQKNHWQKIRTMVNLPVISPFKKRYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYCLARLMAD
  ALRGCVPAFHGVVERDGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAP
  TEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFEEFVQGDEEVLRRYLN
  RLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKTTPLPDGQILDHRRPWEEGNREDGYLLGLDN
  LIGILASLAER

• Structural information:
  • Interpro: IPR005522  IPR038286  
  • PDB: 1W2C 1W2D 1W2F 4UPU
  • PDBsum: 1W2C 1W2D 1W2F 4UPU
  • STRING: ENSP00000260386
• Other Databases: GeneCards:  ITPKA  Malacards:  ITPKA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016301	kinase activity	IBA	molecular function
GO:0051765	inositol tetrakisphosphate kinase activity	IBA	molecular function
GO:0032958	inositol phosphate biosynthetic process	IBA	biological process
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0032958	inositol phosphate biosynthetic process	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0061003	positive regulation of dendritic spine morphogenesis	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0008440	inositol-1,4,5-trisphosphate 3-kinase activity	IEA	molecular function
GO:0043197	dendritic spine	IEA	cellular component
GO:0048365	Rac GTPase binding	IEA	molecular function
GO:0097062	dendritic spine maintenance	IEA	biological process
GO:0006020	inositol metabolic process	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04020	Calcium signaling pathway
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881