• Gene id: 3703

Gene Summary

• Gene Symbol: STT3A   Gene   UCSC   Ensembl
• Aliases: ITM1, STT3-A, TMC
• Gene name: STT3 oligosaccharyltransferase complex catalytic subunit A
• Alternate names: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A, B5, STT3, subunit of the oligosaccharyltransferase complex, homolog A, STT3A, catalytic subunit of the oligosaccharyltransferase complex, STT3A, cataylic subunit of the oligosacchar,
• Gene location: 11q24.2 (5000043: 5742227)     Exons: 12     NC_000024.10
• Gene summary(Entrez): The protein encoded by this gene is a catalytic subunit of the N-oligosaccharyltransferase (OST) complex, which functions in the endoplasmic reticulum to transfer glycan chains to asparagine residues of target proteins. A separate complex containing a sim
• OMIM: 601134

Protein Summary

• Protein general information: P46977  
  • Name: Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit STT3A (Oligosaccharyl transferase subunit STT3A) (STT3 A) (EC 2.4.99.18) (B5) (Integral membrane protein 1) (Transmembrane protein TMC)
  • Length: 705  
  • Mass: 80530
  • Tissue specificity: Expressed at high levels in placenta, liver, muscle and pancreas, and at very low levels in brain, lung and kidney. Expressed in skin fibroblasts (at protein level). {ECO
• Sequence:

  MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHNWFDDR
  AWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKDAGAGLLAAAM
  IAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLV
  LMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFR
  SVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSYYFDLQLLVFMFPVGL
  YYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGIGVSQVLSTYMKNLDISRPDKKSKKQQDSTY
  PIKNEVASGMILVMAFFLITYTFHSTWVTSEAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSW
  WDYGYQITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV
  RIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFEL
  DVLEEAYTTEHWLVRIYKVKDLDNRGLSRT

• Structural information:
  • Interpro: IPR003674  
  • PDB: 6S7O
  • PDBsum: 6S7O
  • STRING: ENSP00000376472
• Other Databases: GeneCards:  STT3A  Malacards:  STT3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008250	oligosaccharyltransferase complex	IDA	is active in
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	IMP	molecular function
GO:0006487	protein N-linked glycosylation	IMP	biological process
GO:0018279	protein N-linked glycosylation via asparagine	IBA	biological process
GO:0043687	post-translational protein modification	IBA	biological process
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	IBA	molecular function
GO:0008250	oligosaccharyltransferase complex	TAS	cellular component
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	IMP	molecular function
GO:0043686	co-translational protein modification	IMP	biological process
GO:0018279	protein N-linked glycosylation via asparagine	IMP	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0004576	oligosaccharyl transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	IEA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	ISS	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	ISS	biological process
GO:0035000	oligosaccharyltransferase III complex	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04141	Protein processing in endoplasmic reticulum
hsa00510	N-Glycan biosynthesis
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
Congenital disorders of glycosylation type I	KEGG:H00118
Congenital disorders of glycosylation type I	KEGG:H00118
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq