• Gene id: 3695

Gene Summary

• Gene Symbol: ITGB7   Gene   UCSC   Ensembl
• Gene name: integrin subunit beta 7
• Alternate names: integrin beta-7, gut homing receptor beta subunit, integrin beta 7 subunit,
• Gene location: 12q13.13 (53207374: 53191317)     Exons: 16     NC_000012.12
• Gene summary(Entrez): This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed o
• OMIM: 602227

Protein Summary

• Protein general information: P26010  
  • Name: Integrin beta 7 (Gut homing receptor beta subunit)
  • Length: 798  
  • Mass: 86903
  • Tissue specificity: Expressed in a variety of leukocyte lines.
• Sequence:

  MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEA
  EARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQLQVRFLRAEGY
  PVDLYYLMDLSYSMKDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQS
  PFSFHHVLSLTGDAQAFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
  GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELSKLIPKSAVGELSEDS
  SNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFWVSLQATHCLP
  EPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLES
  GCRAPNGTGPLCSGKGHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
  DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTGPLATNCSTACAHTNV
  TLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKGADHTQAIVLGCVGGIVAVGLGLVLAYRLSV
  EIYDRREYSRFEKEQQQLNWKQDSNPLYKSAITTTINPRFQEADSPTL

• Structural information:
  • Protein Domains: (150..38-)
    (/note="VWFA"-)
  • Interpro: IPR013111  IPR033760  IPR015812  IPR015437  IPR014836   IPR012896  IPR036349  IPR002369  IPR032695  IPR016201  IPR036465  
  • Prosite: PS00022 PS01186 PS00243
  • PDB: 2BRQ 3V4P 3V4V
  • PDBsum: 2BRQ 3V4P 3V4V
  • DIP: 34970
  • STRING: ENSP00000267082
• Other Databases: GeneCards:  ITGB7  Malacards:  ITGB7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033627	cell adhesion mediated by integrin	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:0005178	integrin binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0008305	integrin complex	TAS	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050900	leukocyte migration	IEA	biological process
GO:0072678	T cell migration	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0034669	integrin alpha4-beta7 complex	IDA	cellular component
GO:0034669	integrin alpha4-beta7 complex	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0050839	cell adhesion molecule binding	IMP	molecular function
GO:0003366	cell-matrix adhesion involved in ameboidal cell migration	IMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0050901	leukocyte tethering or rolling	IMP	biological process
GO:0043113	receptor clustering	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0033627	cell adhesion mediated by integrin	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:0005178	integrin binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0008305	integrin complex	TAS	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050900	leukocyte migration	IEA	biological process
GO:0072678	T cell migration	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0034669	integrin alpha4-beta7 complex	IDA	cellular component
GO:0034669	integrin alpha4-beta7 complex	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0050839	cell adhesion molecule binding	IMP	molecular function
GO:0003366	cell-matrix adhesion involved in ameboidal cell migration	IMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0050901	leukocyte tethering or rolling	IMP	biological process
GO:0043113	receptor clustering	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04810	Regulation of actin cytoskeleton
hsa04510	Focal adhesion
hsa05202	Transcriptional misregulation in cancer
hsa04514	Cell adhesion molecules
hsa05414	Dilated cardiomyopathy
hsa04512	ECM-receptor interaction
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa04672	Intestinal immune network for IgA production

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881