• Gene id: 3693

Gene Summary

• Gene Symbol: ITGB5   Gene   UCSC   Ensembl
• Gene name: integrin subunit beta 5
• Alternate names: integrin beta-5, testis secretory sperm-binding protein Li 217p,
• Gene location: 3q21.2 (124901410: 124761947)     Exons: 18     NC_000003.12
• Gene summary(Entrez): This gene encodes a beta subunit of integrin, which can combine with different alpha chains to form a variety of integrin heterodimers. Integrins are integral cell-surface receptors that participate in cell adhesion as well as cell-surface mediated signal
• OMIM: 147561

Protein Summary

• Protein general information: P18084  
  • Name: Integrin beta 5
  • Length: 799  
  • Mass: 88054
• Sequence:

  MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGC
  GGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSM
  KDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTD
  RVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
  HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINAY
  NSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALRPVGFR
  DSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGR
  GDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQ
  ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKD
  DQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNAMTILLAVVGSILLVGLALLAIWKLLVTIHD
  RREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFNKFNKSYNGTVD

• Structural information:
  • Protein Domains: (27..7-)
    (/note="PSI-)
    (136..37-)
    (/note="VWFA"-)
  • Interpro: IPR040622  IPR027067  IPR033760  IPR015812  IPR014836   IPR012896  IPR036349  IPR002369  IPR032695  IPR016201  IPR002035  IPR036465  
  • Prosite: PS00022 PS01186 PS00243
  • STRING: ENSP00000296181
• Other Databases: GeneCards:  ITGB5  Malacards:  ITGB5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0033627	cell adhesion mediated by integrin	IBA	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0005925	focal adhesion	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0008305	integrin complex	IEA	cellular component
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0045335	phagocytic vesicle	TAS	cellular component
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0034684	integrin alphav-beta5 complex	IDA	cellular component
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0090136	epithelial cell-cell adhesion	IMP	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0043149	stress fiber assembly	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0035987	endodermal cell differentiation	IEP	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04810	Regulation of actin cytoskeleton
hsa04510	Focal adhesion
hsa05205	Proteoglycans in cancer
hsa04145	Phagosome
hsa05414	Dilated cardiomyopathy
hsa04512	ECM-receptor interaction
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R