• Gene id: 3692

Gene Summary

• Gene Symbol: EIF6   Gene   UCSC   Ensembl
• Aliases: CAB, EIF3A, ITGB4BP, b(2)gcn, eIF-6, p27(BBP), p27BBP
• Gene name: eukaryotic translation initiation factor 6
• Alternate names: eukaryotic translation initiation factor 6, B4 integrin interactor, eukaryotic translation initiation factor 3A, p27 beta-4 integrin-binding protein,
• Gene location: 20q11.22 (35284771: 35278905)     Exons: 8     NC_000020.11
• Gene summary(Entrez): Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The pro
• OMIM: 601205

Protein Summary

• Protein general information: P56537  
  • Name: Eukaryotic translation initiation factor 6 (eIF 6) (B(2)GCN homolog) (B4 integrin interactor) (CAB) (p27(BBP))
  • Length: 245  
  • Mass: 26599
  • Tissue specificity: Expressed at very high levels in colon carcinoma with lower levels in normal colon and ileum and lowest levels in kidney and muscle (at protein level). {ECO
• Sequence:

  MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNN
  TTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGS
  YCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLN
  EAQPSTIATSMRDSLIDSLT

• Structural information:
  • Interpro: IPR002769  
  • CDD: cd00527
  • STRING: ENSP00000363574
• Other Databases: GeneCards:  EIF6  Malacards:  EIF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000054	ribosomal subunit export from nucleus	IBA	biological process
GO:0000470	maturation of LSU-rRNA	IBA	biological process
GO:0043023	ribosomal large subunit binding	IBA	molecular function
GO:0000460	maturation of 5.8S rRNA	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:1902626	assembly of large subunit precursor of preribosome	IBA	biological process
GO:0043022	ribosome binding	IDA	molecular function
GO:0045652	regulation of megakaryocyte differentiation	ISS	biological process
GO:0045727	positive regulation of translation	ISS	biological process
GO:0032868	response to insulin	ISS	biological process
GO:0006110	regulation of glycolytic process	ISS	biological process
GO:0042256	mature ribosome assembly	IMP	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	ISS	biological process
GO:0042304	regulation of fatty acid biosynthetic process	ISS	biological process
GO:0035278	miRNA mediated inhibition of translation	IMP	biological process
GO:0035195	gene silencing by miRNA	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043022	ribosome binding	IEA	molecular function
GO:0042256	mature ribosome assembly	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006413	translational initiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0042304	regulation of fatty acid biosynthetic process	IEA	biological process
GO:0005882	intermediate filament	IEA	cellular component
GO:0005638	lamin filament	IEA	cellular component
GO:0045727	positive regulation of translation	IEA	biological process
GO:0045652	regulation of megakaryocyte differentiation	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0006110	regulation of glycolytic process	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0042273	ribosomal large subunit biogenesis	IEA	biological process
GO:0043023	ribosomal large subunit binding	IEA	molecular function
GO:0042256	mature ribosome assembly	IEA	biological process
GO:0000054	ribosomal subunit export from nucleus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006413	translational initiation	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0000054	ribosomal subunit export from nucleus	IBA	biological process
GO:0000470	maturation of LSU-rRNA	IBA	biological process
GO:0043023	ribosomal large subunit binding	IBA	molecular function
GO:0000460	maturation of 5.8S rRNA	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:1902626	assembly of large subunit precursor of preribosome	IBA	biological process
GO:0043022	ribosome binding	IDA	molecular function
GO:0045652	regulation of megakaryocyte differentiation	ISS	biological process
GO:0045727	positive regulation of translation	ISS	biological process
GO:0032868	response to insulin	ISS	biological process
GO:0006110	regulation of glycolytic process	ISS	biological process
GO:0042256	mature ribosome assembly	IMP	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	ISS	biological process
GO:0042304	regulation of fatty acid biosynthetic process	ISS	biological process
GO:0035278	miRNA mediated inhibition of translation	IMP	biological process
GO:0035195	gene silencing by miRNA	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043022	ribosome binding	IEA	molecular function
GO:0042256	mature ribosome assembly	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006413	translational initiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0042304	regulation of fatty acid biosynthetic process	IEA	biological process
GO:0005882	intermediate filament	IEA	cellular component
GO:0005638	lamin filament	IEA	cellular component
GO:0045727	positive regulation of translation	IEA	biological process
GO:0045652	regulation of megakaryocyte differentiation	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0006110	regulation of glycolytic process	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0042273	ribosomal large subunit biogenesis	IEA	biological process
GO:0043023	ribosomal large subunit binding	IEA	molecular function
GO:0042256	mature ribosome assembly	IEA	biological process
GO:0000054	ribosomal subunit export from nucleus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006413	translational initiation	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray