• Gene id: 3690

Gene Summary

• Gene Symbol: ITGB3   Gene   UCSC   Ensembl
• Aliases: BDPLT16, BDPLT2, CD61, GP3A, GPIIIa, GT
• Gene name: integrin subunit beta 3
• Alternate names: integrin beta-3, antigen CD61, integrin beta 3, integrin beta chain, beta 3, integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61), platelet membrane glycoprotein IIIa,
• Gene location: 17q21.32 (47253826: 47313742)     Exons: 2     NC_000017.11
• Gene summary(Entrez): The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is fo
• OMIM: 173470

Protein Summary

• Protein general information: P05106  
  • Name: Integrin beta 3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)
  • Length: 788  
  • Mass: 87058
  • Tissue specificity: Isoform beta-3A and isoform beta-3C are widely expressed. Isoform beta-3A is specifically expressed in osteoblast cells; isoform beta-3C is specifically expressed in prostate and testis.
• Sequence:

  MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNC
  APESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSM
  KDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQ
  VTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
  VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYG
  KIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDS
  LIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRG
  ECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
  CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTG
  KDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDR
  KEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT

• Structural information:
  • Protein Domains: (135..37-)
    (/note="VWFA"-)
  • Interpro: IPR013111  IPR040622  IPR027068  IPR033760  IPR015812   IPR014836  IPR012896  IPR036349  IPR002369  IPR032695  IPR016201  IPR036465  
  • Prosite: PS00022 PS01186 PS00243
  • PDB: 1JV2 1KUP 1KUZ 1L5G 1M1X 1M8O 1MIZ 1MK7 1MK9 1RN0 1S4X 1TYE 1U8C 2INI 2K9J 2KNC 2KV9 2L1C 2L91 2LJD 2LJE 2LJF 2MTP 2N9Y 2Q6W 2RMZ 2RN0 2VC2 2VDK 2VDL 2VDM 2VDN 2VDO 2VDP 2VDQ 2VDR 3FCS 3FCU 3IJE 3NID 3NIF 3NIG 3T3M 3T3P 3ZDX 3ZDY 3ZDZ 3ZE0 3ZE1 3ZE2 4CAK 4G1E 4G1M 4MMX 4MMY 4MMZ 4O02 4Z7N 4Z7O 4Z7Q 5HDB 6AVQ 6AVR 6AV
  • PDBsum: 1JV2 1KUP 1KUZ 1L5G 1M1X 1M8O 1MIZ 1MK7 1MK9 1RN0 1S4X 1TYE 1U8C 2INI 2K9J 2KNC 2KV9 2L1C 2L91 2LJD 2LJE 2LJF 2MTP 2N9Y 2Q6W 2RMZ 2RN0 2VC2 2VDK 2VDL 2VDM 2VDN 2VDO 2VDP 2VDQ 2VDR 3FCS 3FCU 3IJE 3NID 3NIF 3NIG 3T3M 3T3P 3ZDX 3ZDY 3ZDZ 3ZE0 3ZE1 3ZE2 4CAK 4G1E 4G1M 4MMX 4MMY 4MMZ 4O02 4Z7N 4Z7O 4Z7Q 5HDB 6AVQ 6AVR 6AV
  • DIP: 304
  • STRING: ENSP00000452786
• Other Databases: GeneCards:  ITGB3  Malacards:  ITGB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005911	cell-cell junction	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033627	cell adhesion mediated by integrin	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:0005178	integrin binding	IBA	molecular function
GO:0001968	fibronectin binding	IBA	molecular function
GO:0019960	C-X3-C chemokine binding	IDA	contributes to
GO:0017134	fibroblast growth factor binding	IDA	contributes to
GO:0033627	cell adhesion mediated by integrin	IDA	biological process
GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	cellular component
GO:0038132	neuregulin binding	IDA	contributes to
GO:0031994	insulin-like growth factor I binding	IDA	contributes to
GO:0005886	plasma membrane	IDA	cellular component
GO:0015026	coreceptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045202	synapse	ISS	cellular component
GO:0051611	regulation of serotonin uptake	ISS	biological process
GO:0032880	regulation of protein localization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0005178	integrin binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0070527	platelet aggregation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0008305	integrin complex	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0031092	platelet alpha granule membrane	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035866	alphav-beta3 integrin-PKCalpha complex	IDA	cellular component
GO:0005161	platelet-derived growth factor receptor binding	TAS	molecular function
GO:0043184	vascular endothelial growth factor receptor 2 binding	TAS	molecular function
GO:0043184	vascular endothelial growth factor receptor 2 binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0042060	wound healing	IC	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0007229	integrin-mediated signaling pathway	TAS	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IMP	biological process
GO:0010888	negative regulation of lipid storage	IMP	biological process
GO:0014909	smooth muscle cell migration	IMP	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0035295	tube development	TAS	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IMP	biological process
GO:0008305	integrin complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	TAS	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0032147	activation of protein kinase activity	IMP	biological process
GO:0032369	negative regulation of lipid transport	IMP	biological process
GO:0045124	regulation of bone resorption	TAS	biological process
GO:0045715	negative regulation of low-density lipoprotein particle receptor biosynthetic process	IMP	biological process
GO:0050748	negative regulation of lipoprotein metabolic process	IMP	biological process
GO:0060055	angiogenesis involved in wound healing	TAS	biological process
GO:0071062	alphav-beta3 integrin-vitronectin complex	TAS	cellular component
GO:0035868	alphav-beta3 integrin-HMGB1 complex	IDA	cellular component
GO:0043277	apoptotic cell clearance	IGI	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0031258	lamellipodium membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0031527	filopodium membrane	IDA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0050840	extracellular matrix binding	IDA	molecular function
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0031258	lamellipodium membrane	IDA	cellular component
GO:0002020	protease binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0003756	protein disulfide isomerase activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0031528	microvillus membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0042470	melanosome	IDA	cellular component
GO:0003756	protein disulfide isomerase activity	IDA	molecular function
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0048333	mesodermal cell differentiation	IEP	biological process
GO:0007229	integrin-mediated signaling pathway	HDA	biological process
GO:0030168	platelet activation	IMP	biological process
GO:0001968	fibronectin binding	IMP	molecular function
GO:0050919	negative chemotaxis	IMP	biological process
GO:0046718	viral entry into host cell	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0038027	apolipoprotein A-I-mediated signaling pathway	IMP	biological process
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0009986	cell surface	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0070527	platelet aggregation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization	IMP	biological process
GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization	EXP	biological process
GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization	IDA	biological process
GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization	IDA	biological process
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	EXP	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa05206	MicroRNAs in cancer
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04510	Focal adhesion
hsa05205	Proteoglycans in cancer
hsa04145	Phagosome
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa04611	Platelet activation
hsa04919	Thyroid hormone signaling pathway
hsa05414	Dilated cardiomyopathy
hsa04512	ECM-receptor interaction
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Macrothrombocytopenia	KEGG:H01740
Glanzmann thrombasthenia	KEGG:H00226
Macrothrombocytopenia	KEGG:H01740
Glanzmann thrombasthenia	KEGG:H00226
Myelodysplastic syndrome	PMID:16121636
Platelet-type bleeding disorder 16	PMID:23912132
Platelet-type bleeding disorder 16	PMID:22250950
colorectal carcinoma	PMID:11299820
Graves' disease	PMID:23109646
Thrombocytopenia	PMID:19336737
Glanzmann's thrombasthenia	PMID:15634267
Asthma	PMID:17556058
lung non-small cell carcinoma	PMID:19386436
Myocardial infarction	PMID:20846430
Autoimmune thrombocytopenic purpura	PMID:10936026
Diabetic retinopathy	PMID:11375345
acute myeloid leukemia	PMID:23770013
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)