Male Infertility Database

Search Result

Gene id

3688

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

ITGB1 Gene UCSC Ensembl

Aliases

CD29, FNRB, GPIIA, MDF2, MSK12, VLA-BETA, VLAB

Gene name

integrin subunit beta 1

Alternate names

integrin beta-1, glycoprotein IIa, integrin VLA-4 beta subunit, integrin beta 1, integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12), very late activation protein, beta polypeptide,

Gene location

10p11.22 (32958364: 32900317) Exons: 18 NC_000010.11

Gene summary(Entrez)

Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of process

OMIM

135630

Protein Summary

Protein general information

P05556

Name: Integrin beta 1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA 4 subunit beta) (CD antigen CD29)

Length: 798 Mass: 88,415

Sequence

MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGC
PPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMD
LSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSL
TNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAY
NSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGF
TEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEIC
SNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVES
RDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLI
WKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK

Structural information

Protein Domains	VWFA. (140-378)
Interpro:	IPR013111 IPR027071 IPR033760 IPR015812 IPR014836 IPR012896 IPR036349 IPR002369 IPR032695 IPR016201 IPR036465
Prosite:	PS00022 PS00243
PDB:	1K11 1LHA 3G9W 3T9K 3VI3 3VI4 4DX9 4WJK 4WK0 4WK2 4WK4
PDBsum:	1K11 1LHA 3G9W 3T9K 3VI3 3VI4 4DX9 4WJK 4WK0 4WK2 4WK4
DIP:	312
MINT:
STRING:	ENSP00000303351

Other Databases

GeneCards: ITGB1 Malacards: ITGB1

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitoti c cell cycle	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0001701	in utero embryonic develo pment	IEA	biological process
GO:0001708	cell fate specification	IEA	biological process
GO:0001726	ruffle	TAS	cellular component
GO:0001894	tissue homeostasis	IEA	biological process
GO:0001948	glycoprotein binding	IEA	molecular function
GO:0001968	fibronectin binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002042	cell migration involved i n sprouting angiogenesis	IEA	biological process
GO:0003779	actin binding	IDA	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005604	basement membrane	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006874	cellular calcium ion home ostasis	IEA	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	TAS	biological process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007161	calcium-independent cell- matrix adhesion	IGI	biological process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological process
GO:0008277	regulation of G-protein c oupled receptor protein s ignaling pathway	IEA	biological process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological process
GO:0008305	integrin complex	NAS	cellular component
GO:0008354	germ cell migration	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0009897	external side of plasma m embrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010710	regulation of collagen ca tabolic process	IDA	biological process
GO:0010811	positive regulation of ce ll-substrate adhesion	IEA	biological process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological process
GO:0014704	intercalated disc	IEA	cellular component
GO:0014823	response to activity	IEA	biological process
GO:0015026	coreceptor activity	TAS	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0016477	cell migration	TAS	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019904	protein domain specific b inding	IEA	molecular function
GO:0021943	formation of radial glial scaffolds	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0030056	hemidesmosome	IEA	cellular component
GO:0030175	filopodium	IDA	cellular component
GO:0030183	B cell differentiation	IC	biological process
GO:0030198	extracellular matrix orga nization	TAS	biological process
GO:0030335	positive regulation of ce ll migration	IEA	biological process
GO:0031345	negative regulation of ce ll projection organizatio n	IEA	biological process
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0031594	neuromuscular junction	IDA	cellular component
GO:0031623	receptor internalization	ISS	biological process
GO:0032154	cleavage furrow	IEA	cellular component
GO:0032403	protein complex binding	IPI	molecular function
GO:0032587	ruffle membrane	NAS	cellular component
GO:0032594	protein transport within lipid bilayer	IEA	biological process
GO:0033631	cell-cell adhesion mediat ed by integrin	IEP	biological process
GO:0034113	heterotypic cell-cell adh esion	IMP	biological process
GO:0034665	integrin alpha1-beta1 com plex	IDA	cellular component
GO:0034666	integrin alpha2-beta1 com plex	IDA	cellular component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular component
GO:0034677	integrin alpha7-beta1 com plex	IEA	cellular component
GO:0034678	integrin alpha8-beta1 com plex	TAS	cellular component
GO:0034679	integrin alpha9-beta1 com plex	IEA	cellular component
GO:0034680	integrin alpha10-beta1 co mplex	IDA	cellular component
GO:0034681	integrin alpha11-beta1 co mplex	IDA	cellular component
GO:0034698	response to gonadotropin	IEA	biological process
GO:0035024	negative regulation of Rh o protein signal transduc tion	IEA	biological process
GO:0035748	myelin sheath abaxonal re gion	IEA	cellular component
GO:0042277	peptide binding	IEA	molecular function
GO:0042383	sarcolemma	IDA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0043065	positive regulation of ap optotic process	IGI	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0043236	laminin binding	IEA	molecular function
GO:0043410	positive regulation of MA PK cascade	IEA	biological process
GO:0043547	positive regulation of GT Pase activity	IMP	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0045214	sarcomere organization	IEA	biological process
GO:0045665	negative regulation of ne uron differentiation	IEA	biological process
GO:0045807	positive regulation of en docytosis	IEA	biological process
GO:0046718	viral entry into host cel l	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046982	protein heterodimerizatio n activity	IDA	molecular function
GO:0046982	protein heterodimerizatio n activity	NAS	molecular function
GO:0048333	mesodermal cell different iation	IEP	biological process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular component
GO:0048675	axon extension	IEA	biological process
GO:0048813	dendrite morphogenesis	IEA	biological process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological process
GO:0050776	regulation of immune resp onse	TAS	biological process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular function
GO:0050900	leukocyte migration	TAS	biological process
GO:0050901	leukocyte tethering or ro lling	IMP	biological process
GO:0051393	alpha-actinin binding	IEA	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0055007	cardiac muscle cell diffe rentiation	IEA	biological process
GO:0055037	recycling endosome	IEA	cellular component
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070830	bicellular tight junction assembly	IEA	biological process
GO:0071260	cellular response to mech anical stimulus	IEA	biological process
GO:0071305	cellular response to vita min D	IEA	biological process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological process
GO:0071438	invadopodium membrane	IDA	cellular component
GO:0071479	cellular response to ioni zing radiation	IEA	biological process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological process
GO:0097060	synaptic membrane	IEA	cellular component
GO:0098639	collagen binding involved in cell-matrix adhesion	IMP	molecular function
GO:2000811	negative regulation of an oikis	IMP	biological process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological process
GO:0043149	stress fiber assembly	IMP	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0019960	C-X3-C chemokine binding	IDA	molecular function
GO:0000082	G1/S transition of mitoti c cell cycle	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0001701	in utero embryonic develo pment	IEA	biological process
GO:0001708	cell fate specification	IEA	biological process
GO:0001726	ruffle	IEA	cellular component
GO:0001726	ruffle	TAS	cellular component
GO:0001894	tissue homeostasis	IEA	biological process
GO:0001948	glycoprotein binding	IEA	molecular function
GO:0001968	fibronectin binding	IEA	molecular function
GO:0001968	fibronectin binding	IPI	molecular function
GO:0002020	protease binding	IEA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002042	cell migration involved i n sprouting angiogenesis	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0004872	receptor activity	IEA	molecular function
GO:0005102	receptor binding	IEA	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005518	collagen binding	IEA	molecular function
GO:0005604	basement membrane	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006874	cellular calcium ion home ostasis	IEA	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	TAS	biological process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological process
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007161	calcium-independent cell- matrix adhesion	IGI	biological process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological process
GO:0008277	regulation of G-protein c oupled receptor protein s ignaling pathway	IEA	biological process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0008305	integrin complex	IEA	cellular component
GO:0008305	integrin complex	NAS	cellular component
GO:0008354	germ cell migration	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0009897	external side of plasma m embrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010710	regulation of collagen ca tabolic process	IDA	biological process
GO:0010811	positive regulation of ce ll-substrate adhesion	IEA	biological process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological process
GO:0014704	intercalated disc	IEA	cellular component
GO:0014823	response to activity	IEA	biological process
GO:0015026	coreceptor activity	TAS	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0016477	cell migration	TAS	biological process
GO:0019900	kinase binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019904	protein domain specific b inding	IEA	molecular function
GO:0021943	formation of radial glial scaffolds	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030056	hemidesmosome	IEA	cellular component
GO:0030175	filopodium	IDA	cellular component
GO:0030183	B cell differentiation	IC	biological process
GO:0030198	extracellular matrix orga nization	TAS	biological process
GO:0030335	positive regulation of ce ll migration	IEA	biological process
GO:0031175	neuron projection develop ment	IEA	biological process
GO:0031345	negative regulation of ce ll projection organizatio n	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0031594	neuromuscular junction	IDA	cellular component
GO:0031623	receptor internalization	IEA	biological process
GO:0031623	receptor internalization	ISS	biological process
GO:0031667	response to nutrient leve ls	IEA	biological process
GO:0032154	cleavage furrow	IEA	cellular component
GO:0032403	protein complex binding	IEA	molecular function
GO:0032403	protein complex binding	IPI	molecular function
GO:0032587	ruffle membrane	IEA	cellular component
GO:0032587	ruffle membrane	NAS	cellular component
GO:0032594	protein transport within lipid bilayer	IEA	biological process
GO:0033631	cell-cell adhesion mediat ed by integrin	IEP	biological process
GO:0034113	heterotypic cell-cell adh esion	IMP	biological process
GO:0034665	integrin alpha1-beta1 com plex	IDA	cellular component
GO:0034666	integrin alpha2-beta1 com plex	IDA	cellular component
GO:0034667	integrin alpha3-beta1 com plex	IEA	cellular component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular component
GO:0034677	integrin alpha7-beta1 com plex	IEA	cellular component
GO:0034678	integrin alpha8-beta1 com plex	TAS	cellular component
GO:0034679	integrin alpha9-beta1 com plex	IEA	cellular component
GO:0034680	integrin alpha10-beta1 co mplex	IDA	cellular component
GO:0034681	integrin alpha11-beta1 co mplex	IDA	cellular component
GO:0034698	response to gonadotropin	IEA	biological process
GO:0035024	negative regulation of Rh o protein signal transduc tion	IEA	biological process
GO:0035748	myelin sheath abaxonal re gion	IEA	cellular component
GO:0042277	peptide binding	IEA	molecular function
GO:0042383	sarcolemma	IEA	cellular component
GO:0042383	sarcolemma	IEA	cellular component
GO:0042383	sarcolemma	IDA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0043065	positive regulation of ap optotic process	IGI	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0043236	laminin binding	IEA	molecular function
GO:0043410	positive regulation of MA PK cascade	IEA	biological process
GO:0043547	positive regulation of GT Pase activity	IMP	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045214	sarcomere organization	IEA	biological process
GO:0045596	negative regulation of ce ll differentiation	IEA	biological process
GO:0045665	negative regulation of ne uron differentiation	IEA	biological process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological process
GO:0045807	positive regulation of en docytosis	IEA	biological process
GO:0046718	viral entry into host cel l	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular function
GO:0046982	protein heterodimerizatio n activity	IDA	molecular function
GO:0046982	protein heterodimerizatio n activity	NAS	molecular function
GO:0048333	mesodermal cell different iation	IEP	biological process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular component
GO:0048675	axon extension	IEA	biological process
GO:0048738	cardiac muscle tissue dev elopment	IEA	biological process
GO:0048813	dendrite morphogenesis	IEA	biological process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological process
GO:0050776	regulation of immune resp onse	TAS	biological process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular function
GO:0050900	leukocyte migration	TAS	biological process
GO:0050901	leukocyte tethering or ro lling	IMP	biological process
GO:0051393	alpha-actinin binding	IEA	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0055007	cardiac muscle cell diffe rentiation	IEA	biological process
GO:0055037	recycling endosome	IEA	cellular component
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070830	bicellular tight junction assembly	IEA	biological process
GO:0071260	cellular response to mech anical stimulus	IEA	biological process
GO:0071305	cellular response to vita min D	IEA	biological process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	IEA	biological process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological process
GO:0071438	invadopodium membrane	IEA	cellular component
GO:0071438	invadopodium membrane	IDA	cellular component
GO:0071479	cellular response to ioni zing radiation	IEA	biological process
GO:0071559	response to transforming growth factor beta	IEA	biological process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological process
GO:0097060	synaptic membrane	IEA	cellular component
GO:0098639	collagen binding involved in cell-matrix adhesion	IMP	molecular function
GO:2000811	negative regulation of an oikis	IMP	biological process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological process
GO:0043149	stress fiber assembly	IMP	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0019960	C-X3-C chemokine binding	IDA	molecular function
GO:0001726	ruffle	TAS	cellular component
GO:0001968	fibronectin binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006968	cellular defense response	TAS	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	TAS	biological process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007161	calcium-independent cell- matrix adhesion	IGI	biological process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological process
GO:0008305	integrin complex	NAS	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010710	regulation of collagen ca tabolic process	IDA	biological process
GO:0015026	coreceptor activity	TAS	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0016477	cell migration	TAS	biological process
GO:0030175	filopodium	IDA	cellular component
GO:0030183	B cell differentiation	IC	biological process
GO:0030198	extracellular matrix orga nization	TAS	biological process
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0031594	neuromuscular junction	IDA	cellular component
GO:0031623	receptor internalization	ISS	biological process
GO:0032403	protein complex binding	IPI	molecular function
GO:0032587	ruffle membrane	NAS	cellular component
GO:0033631	cell-cell adhesion mediat ed by integrin	IEP	biological process
GO:0034113	heterotypic cell-cell adh esion	IMP	biological process
GO:0034665	integrin alpha1-beta1 com plex	IDA	cellular component
GO:0034666	integrin alpha2-beta1 com plex	IDA	cellular component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular component
GO:0034678	integrin alpha8-beta1 com plex	TAS	cellular component
GO:0034680	integrin alpha10-beta1 co mplex	IDA	cellular component
GO:0034681	integrin alpha11-beta1 co mplex	IDA	cellular component
GO:0042383	sarcolemma	IDA	cellular component
GO:0043065	positive regulation of ap optotic process	IGI	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0043547	positive regulation of GT Pase activity	IMP	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0046982	protein heterodimerizatio n activity	IDA	molecular function
GO:0046982	protein heterodimerizatio n activity	NAS	molecular function
GO:0048333	mesodermal cell different iation	IEP	biological process
GO:0050776	regulation of immune resp onse	TAS	biological process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular function
GO:0050900	leukocyte migration	TAS	biological process
GO:0050901	leukocyte tethering or ro lling	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological process
GO:0071438	invadopodium membrane	IDA	cellular component
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological process
GO:0098639	collagen binding involved in cell-matrix adhesion	IMP	molecular function
GO:2000811	negative regulation of an oikis	IMP	biological process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological process
GO:0043149	stress fiber assembly	IMP	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0019960	C-X3-C chemokine binding	IDA	molecular function

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04512	ECM-receptor interaction
hsa04514	Cell adhesion molecules
hsa04145	Phagosome
hsa04510	Focal adhesion
hsa04530	Tight junction
hsa04810	Regulation of actin cytoskeleton
hsa04611	Platelet activation
hsa04670	Leukocyte transendothelial migration
hsa04360	Axon guidance
hsa05200	Pathways in cancer
hsa05205	Proteoglycans in cancer
hsa05222	Small cell lung cancer
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa05414	Dilated cardiomyopathy
hsa05130	Pathogenic Escherichia coli infection
hsa05131	Shigellosis
hsa05135	Yersinia infection
hsa05133	Pertussis
hsa05100	Bacterial invasion of epithelial cells
hsa05165	Human papillomavirus infection
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis

Diseases

Expand All | Collapse All

Associated diseases	References
Cancer (ovarian)	GAD: 20628624
Cancer (prostate)	GAD: 19064571
Cancer	GAD: 19064571
Atherosclerosis	GAD: 20485444
Brain ischemia	GAD: 18383324
Cardiovascular disease	GAD: 15978110
Myocardial Infarction	GAD: 11776052
Alzheimer's disease	GAD: 16385451
Depression	GAD: 20800221
Psychological disorders	GAD: 20800221
Endometriosis	INFBASE: 8595131
Recurrent pregnancy loss (RPL)	INFBASE: 25218545
Endometriosis	INFBASE: 26357653
Female infertility	INFBASE: 7691869
Fertilizing defects	MIK: 7540183
Implantation�failure	INFBASE: 1378028
Chylothorax	GAD: 18973153
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Fertilizing ability	MIK: 7540183
Sperm quality	MIK: 12801565
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
12801565	Sperm qual ity	82 (62 infertil e, 20 controls)	Male infertility		Show abstract
7540183	Fertilizin g ability	50 semen sample s	Male infertility	alpha 4 alpha 5 beta 1-integrin and alpha 6	Show abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All