• Gene id: 3687

Gene Summary

• Gene Symbol: ITGAX   Gene   UCSC   Ensembl
• Aliases: CD11C, SLEB6
• Gene name: integrin subunit alpha X
• Alternate names: integrin alpha-X, CD11 antigen-like family member C, complement component 3 receptor 4 subunit, integrin alpha X, integrin, alpha X (antigen CD11C (p150), alpha polypeptide), integrin, alpha X (complement component 3 receptor 4 subunit), leu M5, alpha subunit, l,
• Gene location: 16p11.2 (31355166: 31382998)     Exons: 32     NC_000016.10
• Gene summary(Entrez): This gene encodes the integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to
• OMIM: 612693

Protein Summary

• Protein general information: P20702  
  • Name: Integrin alpha X (CD11 antigen like family member C) (Leu M5) (Leukocyte adhesion glycoprotein p150,95 alpha chain) (Leukocyte adhesion receptor p150,95) (CD antigen CD11c)
  • Length: 1163  
  • Mass: 127829
  • Tissue specificity: Predominantly expressed in monocytes and granulocytes.
• Sequence:

  MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGA
  CEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQ
  DIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGF
  TYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE
  LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTW
  SGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVT
  GTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAAL
  TVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
  DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSV
  TLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLR
  PMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPA
  GLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
  SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPV
  ELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGN
  LSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITA
  VLYKVGFFKRQYKEMMEEANGQIAPENGTQTPSPPSEK

• Structural information:
  • Protein Domains: (165..33-)
    (/note="VWFA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00219"-)
  • Interpro: IPR013517  IPR013519  IPR000413  IPR013649  IPR018184   IPR028994  IPR032695  IPR002035  IPR036465  
  • Prosite: PS51470 PS00242 PS50234
  • PDB: 1N3Y 2LUV 3K6S 3K71 3K72 4NEH 4NEN 5ES4
  • PDBsum: 1N3Y 2LUV 3K6S 3K71 3K72 4NEH 4NEN 5ES4
  • DIP: 59369
  • STRING: ENSP00000454623
• Other Databases: GeneCards:  ITGAX  Malacards:  ITGAX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005178	integrin binding	TAS	molecular function
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:1905956	positive regulation of endothelial tube morphogenesis	IMP	biological process
GO:0034689	integrin alphaX-beta2 complex	TAS	cellular component
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0007155	cell adhesion	TAS	biological process
GO:0008305	integrin complex	TAS	cellular component
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	IC	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005178	integrin binding	TAS	molecular function
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:1905956	positive regulation of endothelial tube morphogenesis	IMP	biological process
GO:0034689	integrin alphaX-beta2 complex	TAS	cellular component
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0007155	cell adhesion	TAS	biological process
GO:0008305	integrin complex	TAS	cellular component
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	IC	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa05152	Tuberculosis
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq