• Gene id: 3685

Gene Summary

• Gene Symbol: ITGAV   Gene   UCSC   Ensembl
• Aliases: CD51, MSK8, VNRA, VTNR
• Gene name: integrin subunit alpha V
• Alternate names: integrin alpha-V, antigen identified by monoclonal antibody L230, integrin alphaVbeta3, integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51), vitronectin receptor subunit alpha,
• Gene location: 2q32.1 (186590062: 186680901)     Exons: 31     NC_000002.12
• Gene summary(Entrez): The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is
• OMIM: 193210

Protein Summary

• Protein general information: P06756  
  • Name: Integrin alpha V (Vitronectin receptor) (Vitronectin receptor subunit alpha) (CD antigen CD51) [Cleaved into: Integrin alpha V heavy chain; Integrin alpha V light chain]
  • Length: 1048  
  • Mass: 116,038
• Sequence:

  MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANT
  TQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQ
  EREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKY
  DPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
  QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIA
  PLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYP
  DLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQV
  ELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
  TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIV
  SIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSS
  NLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAML
  HLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
  TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNST
  LVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

• Structural information:
  • Interpro: IPR013517  IPR013519  IPR000413  IPR013649  IPR018184   IPR028994  IPR032695  
  • Prosite: PS51470 PS00242
  • PDB: 1JV2 1L5G 1M1X 1U8C 3IJE 4G1E 4G1M 4MMX 4MMY 4MMZ 4O02 4UM8 4UM9 5FFG 5FFO 5NEM 5NER 5NET 5NEU 6AVQ 6AVR 6AVU
  • PDBsum: 1JV2 1L5G 1M1X 1U8C 3IJE 4G1E 4G1M 4MMX 4MMY 4MMZ 4O02 4UM8 4UM9 5FFG 5FFO 5NEM 5NER 5NET 5NEU 6AVQ 6AVR 6AVU
  • DIP: 31785
  • STRING: ENSP00000261023
• Other Databases: GeneCards:  ITGAV  Malacards:  ITGAV

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEP	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0001968	fibronectin binding	IDA	molecular function
GO:0002020	protease binding	IDA	molecular function
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0005245	voltage-gated calcium channel activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007155	cell adhesion	IDA	biological process
GO:0007160	cell-matrix adhesion	NAS	biological process
GO:0007160	cell-matrix adhesion	IDA	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	NAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008305	integrin complex	NAS	cellular component
GO:0008305	integrin complex	IDA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	ISS	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IMP	biological process
GO:0010888	negative regulation of lipid storage	IMP	biological process
GO:0015026	coreceptor activity	TAS	molecular function
GO:0016020	membrane	ISS	cellular component
GO:0016049	cell growth	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0031258	lamellipodium membrane	IDA	cellular component
GO:0031527	filopodium membrane	IDA	cellular component
GO:0031528	microvillus membrane	IDA	cellular component
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0032369	negative regulation of lipid transport	IMP	biological process
GO:0032587	ruffle membrane	IDA	cellular component
GO:0033690	positive regulation of osteoblast proliferation	IEA	biological process
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034684	integrin alphav-beta5 complex	IDA	cellular component
GO:0034686	integrin alphav-beta8 complex	IDA	cellular component
GO:0034686	integrin alphav-beta8 complex	IDA	cellular component
GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	cellular component
GO:0035987	endodermal cell differentiation	IMP	biological process
GO:0038027	apolipoprotein A-I-mediated signaling pathway	IMP	biological process
GO:0043277	apoptotic cell clearance	IEA	biological process
GO:0045335	phagocytic vesicle	TAS	cellular component
GO:0045715	negative regulation of low-density lipoprotein particle receptor biosynthetic process	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0046718	viral entry into host cell	TAS	biological process
GO:0046718	viral entry into host cell	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0050431	transforming growth factor beta binding	ISS	molecular function
GO:0050748	negative regulation of lipoprotein metabolic process	IMP	biological process
GO:0050764	regulation of phagocytosis	IDA	biological process
GO:0050840	extracellular matrix binding	IDA	molecular function
GO:0050900	leukocyte migration	TAS	biological process
GO:0050919	negative chemotaxis	IMP	biological process
GO:0052066	entry of symbiont into host cell by promotion of host phagocytosis	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	ISS	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	ISS	biological process
GO:1990430	extracellular matrix protein binding	IDA	molecular function
GO:2000425	regulation of apoptotic cell clearance	ISS	biological process
GO:2000536	negative regulation of entry of bacterium into host cell	IDA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0001846	opsonin binding	ISS	molecular function
GO:0005080	protein kinase C binding	ISS	molecular function
GO:0017134	fibroblast growth factor binding	IDA	molecular function
GO:0019960	C-X3-C chemokine binding	IDA	molecular function
GO:0031994	insulin-like growth factor I binding	IDA	molecular function
GO:0038132	neuregulin binding	IDA	molecular function
GO:0001525	angiogenesis	IEP	biological process
GO:0001568	blood vessel development	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0001846	opsonin binding	IEA	molecular function
GO:0001968	fibronectin binding	IDA	molecular function
GO:0002020	protease binding	IDA	molecular function
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0005080	protein kinase C binding	IEA	molecular function
GO:0005245	voltage-gated calcium channel activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IDA	biological process
GO:0007160	cell-matrix adhesion	NAS	biological process
GO:0007160	cell-matrix adhesion	IDA	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	NAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0008305	integrin complex	NAS	cellular component
GO:0008305	integrin complex	IDA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	ISS	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IMP	biological process
GO:0010888	negative regulation of lipid storage	IMP	biological process
GO:0015026	coreceptor activity	TAS	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016049	cell growth	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0031258	lamellipodium membrane	IDA	cellular component
GO:0031527	filopodium membrane	IDA	cellular component
GO:0031528	microvillus membrane	IDA	cellular component
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0032369	negative regulation of lipid transport	IMP	biological process
GO:0032587	ruffle membrane	IDA	cellular component
GO:0033690	positive regulation of osteoblast proliferation	IEA	biological process
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034684	integrin alphav-beta5 complex	IDA	cellular component
GO:0034686	integrin alphav-beta8 complex	IDA	cellular component
GO:0034686	integrin alphav-beta8 complex	IDA	cellular component
GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	cellular component
GO:0035987	endodermal cell differentiation	IMP	biological process
GO:0038027	apolipoprotein A-I-mediated signaling pathway	IMP	biological process
GO:0043277	apoptotic cell clearance	IEA	biological process
GO:0045335	phagocytic vesicle	TAS	cellular component
GO:0045715	negative regulation of low-density lipoprotein particle receptor biosynthetic process	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0046718	viral entry into host cell	TAS	biological process
GO:0046718	viral entry into host cell	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0050431	transforming growth factor beta binding	ISS	molecular function
GO:0050748	negative regulation of lipoprotein metabolic process	IMP	biological process
GO:0050764	regulation of phagocytosis	IDA	biological process
GO:0050840	extracellular matrix binding	IDA	molecular function
GO:0050900	leukocyte migration	TAS	biological process
GO:0050919	negative chemotaxis	IMP	biological process
GO:0052066	entry of symbiont into host cell by promotion of host phagocytosis	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	IEA	biological process
GO:0070371	ERK1 and ERK2 cascade	ISS	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	ISS	biological process
GO:1990430	extracellular matrix protein binding	IDA	molecular function
GO:2000425	regulation of apoptotic cell clearance	IEA	biological process
GO:2000425	regulation of apoptotic cell clearance	ISS	biological process
GO:2000536	negative regulation of entry of bacterium into host cell	IDA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0001846	opsonin binding	ISS	molecular function
GO:0005080	protein kinase C binding	ISS	molecular function
GO:0017134	fibroblast growth factor binding	IDA	molecular function
GO:0019960	C-X3-C chemokine binding	IDA	molecular function
GO:0031994	insulin-like growth factor I binding	IDA	molecular function
GO:0038132	neuregulin binding	IDA	molecular function
GO:0001525	angiogenesis	IEP	biological process
GO:0001968	fibronectin binding	IDA	molecular function
GO:0002020	protease binding	IDA	molecular function
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0005245	voltage-gated calcium channel activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007155	cell adhesion	IDA	biological process
GO:0007160	cell-matrix adhesion	NAS	biological process
GO:0007160	cell-matrix adhesion	IDA	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	NAS	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008305	integrin complex	NAS	cellular component
GO:0008305	integrin complex	IDA	cellular component
GO:0009986	cell surface	ISS	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IMP	biological process
GO:0010888	negative regulation of lipid storage	IMP	biological process
GO:0015026	coreceptor activity	TAS	molecular function
GO:0016020	membrane	ISS	cellular component
GO:0016049	cell growth	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0031258	lamellipodium membrane	IDA	cellular component
GO:0031527	filopodium membrane	IDA	cellular component
GO:0031528	microvillus membrane	IDA	cellular component
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0032369	negative regulation of lipid transport	IMP	biological process
GO:0032587	ruffle membrane	IDA	cellular component
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034683	integrin alphav-beta3 complex	IDA	cellular component
GO:0034684	integrin alphav-beta5 complex	IDA	cellular component
GO:0034686	integrin alphav-beta8 complex	IDA	cellular component
GO:0034686	integrin alphav-beta8 complex	IDA	cellular component
GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	cellular component
GO:0035987	endodermal cell differentiation	IMP	biological process
GO:0038027	apolipoprotein A-I-mediated signaling pathway	IMP	biological process
GO:0045335	phagocytic vesicle	TAS	cellular component
GO:0045715	negative regulation of low-density lipoprotein particle receptor biosynthetic process	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0046718	viral entry into host cell	TAS	biological process
GO:0046718	viral entry into host cell	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0050431	transforming growth factor beta binding	ISS	molecular function
GO:0050748	negative regulation of lipoprotein metabolic process	IMP	biological process
GO:0050764	regulation of phagocytosis	IDA	biological process
GO:0050840	extracellular matrix binding	IDA	molecular function
GO:0050900	leukocyte migration	TAS	biological process
GO:0050919	negative chemotaxis	IMP	biological process
GO:0052066	entry of symbiont into host cell by promotion of host phagocytosis	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	ISS	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	ISS	biological process
GO:1990430	extracellular matrix protein binding	IDA	molecular function
GO:2000425	regulation of apoptotic cell clearance	ISS	biological process
GO:2000536	negative regulation of entry of bacterium into host cell	IDA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0001846	opsonin binding	ISS	molecular function
GO:0005080	protein kinase C binding	ISS	molecular function
GO:0017134	fibroblast growth factor binding	IDA	molecular function
GO:0019960	C-X3-C chemokine binding	IDA	molecular function
GO:0031994	insulin-like growth factor I binding	IDA	molecular function
GO:0038132	neuregulin binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04512	ECM-receptor interaction
hsa04514	Cell adhesion molecules
hsa04145	Phagosome
hsa04510	Focal adhesion
hsa04810	Regulation of actin cytoskeleton
hsa04919	Thyroid hormone signaling pathway
hsa05200	Pathways in cancer
hsa05205	Proteoglycans in cancer
hsa05222	Small cell lung cancer
hsa05418	Fluid shear stress and atherosclerosis
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa05414	Dilated cardiomyopathy
hsa05163	Human cytomegalovirus infection
hsa05165	Human papillomavirus infection

Diseases

Associated diseases	References
Cancer	GAD: 18550570
Cancer (Hepatocellular)	GAD: 18694400
Cancer (breast)	GAD: 18550570
Cancer (ovarian)	GAD: 20628624
Arthritis	GAD: 19818132
Rheumatoid arthritis	GAD: 17615072
Endometriosis	INFBASE: 22215628
Female infertility	INFBASE: 7519194
Recurrent implantation failure (RIF)	INFBASE: 23755950
Impaired endometrial receptivity	INFBASE: 20193421
Implantation failure	INFBASE: 8962647
Polycystic ovary syndrome (PCOS)	INFBASE: 18353318
Recurrent pregnancy loss (RPL)	INFBASE: 21109038
Unexplained infertility	INFBASE: 24690239
Uterine receptivity	INFBASE: 7519194
Uterine receptivity in the window of implantation	INFBASE: 8774273
Impaired human spermatogenesis	INFBASE: 21505981
Disturbed implantation and placentation	INFBASE: 21109038
Delayed implantation	INFBASE: 21505981
Priapism	GAD: 17408468
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 19062002
Male infertility	MIK: 19062002

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19062002	Varicocele, Male infertility			24 (8 infertile varicocele patients, 16 fertile volunteers)	Male infertility	PARP-1 poly(ADP-ribose) X-ray repair cross-complementing 1 and apurinic/apyrimidinic endonuclease 1] caspase 9 active caspase 3 and cleaved PARP-1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq