• Gene id: 3684

Gene Summary

• Gene Symbol: ITGAM   Gene   UCSC   Ensembl
• Aliases: CD11B, CR3A, MAC-1, MAC1A, MO1A, SLEB6
• Gene name: integrin subunit alpha M
• Alternate names: integrin alpha-M, CD11 antigen-like family member B, CR-3 alpha chain, antigen CD11b (p170), cell surface glycoprotein MAC-1 subunit alpha, complement component 3 receptor 3 subunit, integrin, alpha M (complement component 3 receptor 3 subunit), leukocyte adhesi,
• Gene location: 16p11.2 (31259974: 31332876)     Exons: 31     NC_000016.10
• Gene summary(Entrez): This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific i
• OMIM: 120980

Protein Summary

• Protein general information: P11215  
  • Name: Integrin alpha M (CD11 antigen like family member B) (CR 3 alpha chain) (Cell surface glycoprotein MAC 1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b)
  • Length: 1152  
  • Mass: 127179
  • Tissue specificity: Predominantly expressed in monocytes and granulocytes (PubMed
• Sequence:

  MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYSTGSCEP
  IRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSD
  IAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRT
  HTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
  NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAITSNGPLLSTVGSYDWA
  GGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLVLGAPRYQHIGLVAMFRQNTGMWESNANVKG
  TQIGAYFGASLCSVDVDSNGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALT
  VLGDVNGDKLTDVAIGAPGEEDNRGAVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
  LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKSTRDRLREGQIQSVVT
  YDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPNCIEDPVSPIVLRLNFSLVGTPLSAFGNLRP
  VLAEDAQRLFTALFPFEKNCGNDNICQDDLSITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLD
  LSYRKVSTLQNQRSQRSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
  VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLVPV
  RLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVVNCSIAVCQRIQCDIPFFGIQEEFNATLKGN
  LSFDWYIKTSHNHLLIVSTAEILFNDSVFTLLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITA
  ALYKLGFFKRQYKDMMSEGGPPGAEPQ

• Structural information:
  • Protein Domains: (150..32-)
    (/note="VWFA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00219"-)
  • Interpro: IPR013517  IPR013519  IPR000413  IPR013649  IPR018184   IPR028994  IPR032695  IPR002035  IPR036465  
  • Prosite: PS51470 PS00242 PS50234
  • PDB: 1A8X 1BHO 1BHQ 1IDN 1IDO 1JLM 1M1U 1MF7 1N9Z 1NA5 2LKE 2LKJ 3Q3G 3QA3 4M76 4XW2 6RHW
  • PDBsum: 1A8X 1BHO 1BHQ 1IDN 1IDO 1JLM 1M1U 1MF7 1N9Z 1NA5 2LKE 2LKJ 3Q3G 3QA3 4M76 4XW2 6RHW
  • STRING: ENSP00000441691
• Other Databases: GeneCards:  ITGAM  Malacards:  ITGAM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	IC	molecular function
GO:0001851	complement component C3b binding	ISS	molecular function
GO:0005178	integrin binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0038024	cargo receptor activity	ISS	molecular function
GO:0038024	cargo receptor activity	ISS	contributes to
GO:2000363	positive regulation of prostaglandin-E synthase activity	ISS	biological process
GO:0098742	cell-cell adhesion via plasma-membrane adhesion molecules	NAS	biological process
GO:1901216	positive regulation of neuron death	ISS	biological process
GO:0006898	receptor-mediated endocytosis	ISS	biological process
GO:0006898	receptor-mediated endocytosis	ISS	biological process
GO:0150064	vertebrate eye-specific patterning	ISS	biological process
GO:0006911	phagocytosis, engulfment	ISS	biological process
GO:0006911	phagocytosis, engulfment	ISS	biological process
GO:0006911	phagocytosis, engulfment	ISS	biological process
GO:1905114	cell surface receptor signaling pathway involved in cell-cell signaling	ISS	biological process
GO:0110090	positive regulation of hippocampal neuron apoptotic process	ISS	biological process
GO:0034688	integrin alphaM-beta2 complex	ISS	cellular component
GO:0150062	complement-mediated synapse pruning	ISS	biological process
GO:0009897	external side of plasma membrane	NAS	cellular component
GO:0097190	apoptotic signaling pathway	ISS	biological process
GO:0045963	negative regulation of dopamine metabolic process	ISS	biological process
GO:0001774	microglial cell activation	ISS	biological process
GO:0001774	microglial cell activation	ISS	biological process
GO:0032930	positive regulation of superoxide anion generation	ISS	biological process
GO:0032930	positive regulation of superoxide anion generation	ISS	biological process
GO:0090314	positive regulation of protein targeting to membrane	ISS	biological process
GO:0030900	forebrain development	ISS	biological process
GO:0097242	amyloid-beta clearance	ISS	biological process
GO:0097242	amyloid-beta clearance	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0008305	integrin complex	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0034142	toll-like receptor 4 signaling pathway	TAS	biological process
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0044853	plasma membrane raft	IDA	cellular component
GO:0010668	ectodermal cell differentiation	IEP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:1904151	positive regulation of microglial cell mediated cytotoxicity	ISS	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0032930	positive regulation of superoxide anion generation	IGI	biological process
GO:0043315	positive regulation of neutrophil degranulation	IGI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05202	Transcriptional misregulation in cancer
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa04514	Cell adhesion molecules
hsa04670	Leukocyte transendothelial migration
hsa05150	Staphylococcus aureus infection
hsa05146	Amoebiasis
hsa04640	Hematopoietic cell lineage
hsa04610	Complement and coagulation cascades
hsa05133	Pertussis
hsa05221	Acute myeloid leukemia
hsa05140	Leishmaniasis
hsa05134	Legionellosis

Diseases

Associated diseases	References
Lupus nephritis	PMID:21719445
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R