• Gene id: 3683

Gene Summary

• Gene Symbol: ITGAL   Gene   UCSC   Ensembl
• Aliases: CD11A, LFA-1, LFA1A
• Gene name: integrin subunit alpha L
• Alternate names: integrin alpha-L, CD11 antigen-like family member A, LFA-1 alpha, LFA-1A, antigen CD11A (p180), lymphocyte function-associated antigen 1, alpha polypeptide, integrin gene promoter, integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen ,
• Gene location: 16p11.2 (30472682: 30523184)     Exons: 31     NC_000016.10
• Gene summary(Entrez): ITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte fu
• OMIM: 603234

Protein Summary

• Protein general information: P20701  
  • Name: Integrin alpha L (CD11 antigen like family member A) (Leukocyte adhesion glycoprotein LFA 1 alpha chain) (LFA 1A) (Leukocyte function associated molecule 1 alpha chain) (CD antigen CD11a)
  • Length: 1170  
  • Mass: 128770
  • Tissue specificity: Leukocytes. {ECO
• Sequence:

  MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGAPGEGNSTGSLYQCQS
  GTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCDQNTYLSGLCYLFRQNLQGPMLQGRPGFQEC
  IKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVK
  HMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
  KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSRGHAVVGAVGAKDWAG
  GFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLLASGAPRYQHMGRVLLFQEPQGGGHWSQVQT
  IHGTQIGSYFGGELCGVDVDQDGETELLLIGAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAI
  TALTDINGDGLVDVAVGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
  VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLIPQFQGRLVANLTYTL
  QLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQRAQGKDI
  PPILRPSLHSETWEIPFEKNCGEDKKCEANLRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPP
  GLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
  NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGV
  PQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFS
  LCSSLSISFNSSKHFHLYGSNASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKM
  EAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD

• Structural information:
  • Protein Domains: (156..32-)
    (/note="VWFA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00219"-)
  • Interpro: IPR013517  IPR013519  IPR000413  IPR013649  IPR018184   IPR028994  IPR032695  IPR002035  IPR036465  
  • Prosite: PS51470 PS00242 PS50234
  • PDB: 1CQP 1DGQ 1IJ4 1LFA 1MJN 1MQ8 1MQ9 1MQA 1RD4 1T0P 1XDD 1XDG 1XUO 1ZON 1ZOO 1ZOP 2ICA 2K8O 2M3E 2O7N 3BN3 3BQM 3BQN 3E2M 3EOA 3EOB 3F74 3F78 3HI6 3M6F 3TCX 4IXD 5E6R 5E6S 5E6U 6BXB 6BXF 6BXJ 6CKB
  • PDBsum: 1CQP 1DGQ 1IJ4 1LFA 1MJN 1MQ8 1MQ9 1MQA 1RD4 1T0P 1XDD 1XDG 1XUO 1ZON 1ZOO 1ZOP 2ICA 2K8O 2M3E 2O7N 3BN3 3BQM 3BQN 3E2M 3EOA 3EOB 3F74 3F78 3HI6 3M6F 3TCX 4IXD 5E6R 5E6S 5E6U 6BXB 6BXF 6BXJ 6CKB
  • DIP: 623
  • STRING: ENSP00000349252
• Other Databases: GeneCards:  ITGAL  Malacards:  ITGAL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035683	memory T cell extravasation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007159	leukocyte cell-cell adhesion	IMP	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006909	phagocytosis	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0008305	integrin complex	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0098609	cell-cell adhesion	ISS	biological process
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	biological process
GO:0007159	leukocyte cell-cell adhesion	IMP	biological process
GO:0002291	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0034687	integrin alphaL-beta2 complex	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0043113	receptor clustering	IMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030369	ICAM-3 receptor activity	IMP	molecular function
GO:0008305	integrin complex	NAS	cellular component
GO:0006954	inflammatory response	NAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0007155	cell adhesion	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa04514	Cell adhesion molecules
hsa04670	Leukocyte transendothelial migration
hsa04650	Natural killer cell mediated cytotoxicity
hsa05150	Staphylococcus aureus infection
hsa05323	Rheumatoid arthritis
hsa05416	Viral myocarditis
hsa05144	Malaria

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq