• Gene id: 3680

Gene Summary

• Gene Symbol: ITGA9   Gene   UCSC   Ensembl
• Aliases: ALPHA-RLC, ITGA4L, RLC
• Gene name: integrin subunit alpha 9
• Alternate names: integrin alpha-9, integrin alpha-RLC,
• Gene location: 3p22.2 (37452140: 37823506)     Exons: 28     NC_000003.12
• Gene summary(Entrez): This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane glycoproteins composed of an alpha chain and a beta chain that mediate cell-cell and cell-matrix adhesion. The protein encoded by this gene, when bound to the beta 1 chain,
• OMIM: 602033

Protein Summary

• Protein general information: Q13797  
  • Name: Integrin alpha 9 (Integrin alpha RLC)
  • Length: 1035  
  • Mass: 114489
  • Tissue specificity: In airway epithelium, in the basal layer of squamous epithelium, and in smooth muscle, skeletal muscle, and hepatocytes. Abundantly expressed in fetal lung and lung cancers. {ECO
• Sequence:

  MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYS
  PSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIY
  YEADHILPHGFCYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLN
  LTDNTYLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTIDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKM
  GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAYNAHFGESIASLDDLD
  NDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGQKINPVLRMFGQSISGGIDMDGNGYPDVTVGAFM
  SDSVVLLRARPVITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKG
  QMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVL
  RWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGKLLLSSMDEKTLYLALGAVKNISLNISISNLGDDAYDANVSF
  NVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEEVLSFIVTAQSGNTER
  SESLHDNTLVLMVPLMHEVDTSITGIMSPTSFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSV
  SISFPNRLSSGGAEMFHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
  AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPEEVTVVFEALHNLEPR
  GYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKNQ

• Structural information:
  • Interpro: IPR013517  IPR013519  IPR000413  IPR013649  IPR018184   IPR028994  IPR032695  
  • Prosite: PS51470 PS00242
  • STRING: ENSP00000264741
• Other Databases: GeneCards:  ITGA9  Malacards:  ITGA9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007155	cell adhesion	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0008305	integrin complex	TAS	cellular component
GO:0007155	cell adhesion	IGI	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0034679	integrin alpha9-beta1 complex	IEA	cellular component
GO:0009925	basal plasma membrane	IEA	cellular component
GO:0043236	laminin binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005518	collagen binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04810	Regulation of actin cytoskeleton
hsa04510	Focal adhesion
hsa04514	Cell adhesion molecules
hsa05414	Dilated cardiomyopathy
hsa04512	ECM-receptor interaction
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy

Diseases

Associated diseases	References
Congenital muscular dystrophies	KEGG:H00590
Congenital muscular dystrophies	KEGG:H00590
Hypertension	PMID:20479155
pancreatic cancer	PMID:18772397
Cerebral infarction	PMID:21764681
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq