• Gene id: 3678

Gene Summary

• Gene Symbol: ITGA5   Gene   UCSC   Ensembl
• Aliases: CD49e, FNRA, VLA-5, VLA5A
• Gene name: integrin subunit alpha 5
• Alternate names: integrin alpha-5, CD49 antigen-like family member E, ITGA5/SLC9B1 fusion, fibronectin receptor subunit alpha, fibronectin receptor, alpha polypeptide, fibronectin receptor, alpha subunit, integrin alpha-F, integrin, alpha 5 (fibronectin receptor, alpha po,
• Gene location: 12q13.13 (54419265: 54395260)     Exons: 31     NC_000012.12
• Gene summary(Entrez): The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is
• OMIM: 135620

Protein Summary

• Protein general information: P08648  
  • Name: Integrin alpha 5 (CD49 antigen like family member E) (Fibronectin receptor subunit alpha) (Integrin alpha F) (VLA 5) (CD antigen CD49e) [Cleaved into: Integrin alpha 5 heavy chain; Integrin alpha 5 light chain]
  • Length: 1049  
  • Mass: 114,536
• Sequence:

  MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPGTDGVS
  VLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGEEPVEYKSLQWFGATVRAHG
  SSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPG
  SYFWQGQILSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTY
  GYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYVYLQHPAGI
  EPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGGPGGLGSKPSQVLQPLWAAS
  HTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINL
  SFCLNASGKHVADSIGFTVELQLDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDK
  LSPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDKNALN
  LTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFT
  VPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPA
  VHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRS
  SASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQL
  PQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA

• Structural information:
  • Interpro: IPR013517  IPR013519  IPR000413  IPR013649  IPR018184   IPR028994  IPR032695  
  • Prosite: PS51470 PS00242
  • PDB: 3VI3 3VI4 4WJK 4WK0 4WK2 4WK4
  • PDBsum: 3VI3 3VI4 4WJK 4WK0 4WK2 4WK4
  • DIP: 40037
  • STRING: ENSP00000293379
• Other Databases: GeneCards:  ITGA5  Malacards:  ITGA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	TAS	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0001726	ruffle	TAS	cellular component
GO:0005154	epidermal growth factor receptor binding	IEA	molecular function
GO:0005161	platelet-derived growth factor receptor binding	TAS	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007044	cell-substrate junction assembly	IEA	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0007159	leukocyte cell-cell adhesion	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0033631	cell-cell adhesion mediated by integrin	IEA	biological process
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0035313	wound healing, spreading of epidermal cells	IEP	biological process
GO:0035987	endodermal cell differentiation	IMP	biological process
GO:0043184	vascular endothelial growth factor receptor 2 binding	TAS	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IMP	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0071062	alphav-beta3 integrin-vitronectin complex	TAS	cellular component
GO:1903672	positive regulation of sprouting angiogenesis	IMP	biological process
GO:2000811	negative regulation of anoikis	IMP	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0001525	angiogenesis	TAS	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0001726	ruffle	TAS	cellular component
GO:0005154	epidermal growth factor receptor binding	IEA	molecular function
GO:0005161	platelet-derived growth factor receptor binding	TAS	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007044	cell-substrate junction assembly	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0007159	leukocyte cell-cell adhesion	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0008305	integrin complex	IEA	cellular component
GO:0008305	integrin complex	TAS	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0033631	cell-cell adhesion mediated by integrin	IEA	biological process
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0035313	wound healing, spreading of epidermal cells	IEP	biological process
GO:0035987	endodermal cell differentiation	IMP	biological process
GO:0043184	vascular endothelial growth factor receptor 2 binding	TAS	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IMP	biological process
GO:0050839	cell adhesion molecule binding	IEA	molecular function
GO:0050900	leukocyte migration	TAS	biological process
GO:0071062	alphav-beta3 integrin-vitronectin complex	TAS	cellular component
GO:1903672	positive regulation of sprouting angiogenesis	IMP	biological process
GO:2000811	negative regulation of anoikis	IMP	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0001525	angiogenesis	TAS	biological process
GO:0001726	ruffle	TAS	cellular component
GO:0005161	platelet-derived growth factor receptor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0008305	integrin complex	TAS	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0034113	heterotypic cell-cell adhesion	IMP	biological process
GO:0035313	wound healing, spreading of epidermal cells	IEP	biological process
GO:0035987	endodermal cell differentiation	IMP	biological process
GO:0043184	vascular endothelial growth factor receptor 2 binding	TAS	molecular function
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IMP	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0071062	alphav-beta3 integrin-vitronectin complex	TAS	cellular component
GO:1903672	positive regulation of sprouting angiogenesis	IMP	biological process
GO:2000811	negative regulation of anoikis	IMP	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04512	ECM-receptor interaction
hsa04145	Phagosome
hsa04510	Focal adhesion
hsa04810	Regulation of actin cytoskeleton
hsa04640	Hematopoietic cell lineage
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa05414	Dilated cardiomyopathy
hsa05131	Shigellosis
hsa05135	Yersinia infection
hsa05133	Pertussis
hsa05100	Bacterial invasion of epithelial cells
hsa05168	Herpes simplex virus 1 infection
hsa05165	Human papillomavirus infection

Diseases

Associated diseases	References
Fertilizing defects	INFBASE: 7540183
Oocyte maturation	INFBASE: 15526973
Teratozoospermia	MIK: 8270377
Male factor infertility	MIK: 8270377
Teratozoospermia	MIK: 8270377
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Fertilizing ability	MIK: 7540183
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
8270377	Teratozoospermia				Male infertility	VLA alpha 4 VLA alpha 5 and laminin
7540183	Fertilizing ability			50 semen samples	Male infertility	alpha 4 alpha 5 beta 1-integrin and alpha 6
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881