• Gene id: 3673

Gene Summary

• Gene Symbol: ITGA2   Gene   UCSC   Ensembl
• Aliases: BR, CD49B, GPIa, HPA-5, VLA-2, VLAA2
• Gene name: integrin subunit alpha 2
• Alternate names: integrin alpha-2, CD49 antigen-like family member B, alpha 2 subunit of VLA-2 receptor, collagen receptor, human platelet alloantigen system 5, integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), platelet antigen Br, platelet glycoprotein GPIa, platelet,
• Gene location: 5q11.2 (52989351: 53094778)     Exons: 47     NC_000005.10
• Gene summary(Entrez): This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss o
• OMIM: 192974

Protein Summary

• Protein general information: P17301  
  • Name: Integrin alpha 2 (CD49 antigen like family member B) (Collagen receptor) (Platelet membrane glycoprotein Ia) (GPIa) (VLA 2 subunit alpha) (CD antigen CD49b)
  • Length: 1181  
  • Mass: 129295
• Sequence:

  MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPEN
  RMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILTRNMGTGGFLTCGPLWAQQCGNQYYTTGVCS
  DISPDFQLSASFSPATQPCPSLIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFN
  LNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
  HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSIEGTVQGGDNFQ
  MEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFPKQAFDQILQDRNHSSYLGYSVAAISTGEST
  HFVAGAPRANYTGQIVLYSVNENGNITVIQAHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEG
  RVYLFTIKKGILGQHQFLEGPEGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKY
  SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEASFTPEKITLVNKNAQI
  ILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDV
  VNSLDLRVDISLENPGTSPALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTF
  SVTLKNKRESAYNTGIVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
  NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSL
  KVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNC
  RTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPD
  EKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS

• Structural information:
  • Protein Domains: (188..36-)
    (/note="VWFA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00219"-)
  • Interpro: IPR013517  IPR013519  IPR000413  IPR013649  IPR018184   IPR028994  IPR032695  IPR002035  IPR036465  
  • Prosite: PS51470 PS00242 PS50234
  • PDB: 1AOX 1DZI 1PQB 1V7P 4BJ3 5HJ2 5THP 6ND8 6ND9 6NDA 6NDB 6NDC 6NDD 6NDE 6NDF 6NDG 6NDH
  • PDBsum: 1AOX 1DZI 1PQB 1V7P 4BJ3 5HJ2 5THP 6ND8 6ND9 6NDA 6NDB 6NDC 6NDD 6NDE 6NDF 6NDG 6NDH
  • DIP: 67
  • STRING: ENSP00000296585
• Other Databases: GeneCards:  ITGA2  Malacards:  ITGA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	ISS	molecular function
GO:0043395	heparan sulfate proteoglycan binding	TAS	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0008305	integrin complex	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005518	collagen binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0008305	integrin complex	TAS	cellular component
GO:0007160	cell-matrix adhesion	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045178	basal part of cell	IEA	cellular component
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0071107	response to parathyroid hormone	IEA	biological process
GO:0050966	detection of mechanical stimulus involved in sensory perception of pain	IEA	biological process
GO:0050927	positive regulation of positive chemotaxis	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048041	focal adhesion assembly	IEA	biological process
GO:0045987	positive regulation of smooth muscle contraction	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0043388	positive regulation of DNA binding	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0042060	wound healing	IEA	biological process
GO:0033591	response to L-ascorbic acid	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0014850	response to muscle activity	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0010694	positive regulation of alkaline phosphatase activity	IEA	biological process
GO:0010634	positive regulation of epithelial cell migration	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0006971	hypotonic response	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0001540	amyloid-beta binding	IEA	molecular function
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0070365	hepatocyte differentiation	IEA	biological process
GO:0060100	positive regulation of phagocytosis, engulfment	IEA	biological process
GO:0051971	positive regulation of transmission of nerve impulse	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0045785	positive regulation of cell adhesion	IEA	biological process
GO:0045184	establishment of protein localization	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043679	axon terminus	IEA	cellular component
GO:0043589	skin morphogenesis	IEA	biological process
GO:0043236	laminin binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0033343	positive regulation of collagen binding	IEA	biological process
GO:0032967	positive regulation of collagen biosynthetic process	IEA	biological process
GO:0031346	positive regulation of cell projection organization	IEA	biological process
GO:0030879	mammary gland development	IEA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IEA	biological process
GO:0014075	response to amine	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0008283	cell population proliferation	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005518	collagen binding	IEA	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0002687	positive regulation of leukocyte migration	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0034666	integrin alpha2-beta1 complex	IDA	cellular component
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0098639	collagen binding involved in cell-matrix adhesion	IMP	molecular function
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0005518	collagen binding	IMP	molecular function
GO:0038065	collagen-activated signaling pathway	IMP	biological process
GO:0038064	collagen receptor activity	IMP	molecular function
GO:0048333	mesodermal cell differentiation	IEP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0033627	cell adhesion mediated by integrin	IMP	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0009986	cell surface	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0006929	substrate-dependent cell migration	IMP	biological process
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04810	Regulation of actin cytoskeleton
hsa04510	Focal adhesion
hsa05205	Proteoglycans in cancer
hsa04145	Phagosome
hsa04611	Platelet activation
hsa05414	Dilated cardiomyopathy
hsa04512	ECM-receptor interaction
hsa05410	Hypertrophic cardiomyopathy
hsa05222	Small cell lung cancer
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Bleeding disorder platelet-type	KEGG:H01235
Bleeding disorder platelet-type	KEGG:H01235
von Willebrand's disease 1	PMID:15226188
von Willebrand's disease 2	PMID:16409463
Thrombosis	PMID:14563646
Sensorineural hearing loss	PMID:22948415
iron deficiency anemia	PMID:12225391
Behcet's disease	PMID:12412731
Thrombocytopenia	PMID:22133274
Retinal vein occlusion	PMID:12928694
Glanzmann's thrombasthenia	PMID:14687991
Arteriosclerosis	PMID:11978651
Myocardial infarction	PMID:10194421
intermediate coronary syndrome	PMID:15104219
Diabetic retinopathy	PMID:12540964
diabetes mellitus	PMID:17466965
type 2 diabetes mellitus	PMID:15025679
type 2 diabetes mellitus	PMID:15025679
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)