• Gene id: 3669

Gene Summary

• Gene Symbol: ISG20   Gene   UCSC   Ensembl
• Aliases: CD25, HEM45
• Gene name: interferon stimulated exonuclease gene 20
• Alternate names: interferon-stimulated gene 20 kDa protein, estrogen-regulated transcript 45 protein, interferon stimulated exonuclease gene 20kDa, promyelocytic leukemia nuclear body-associated protein ISG20,
• Gene location: 15q26.1 (57668039: 57701186)     Exons: 15     NC_000011.10
• OMIM: 604533

Protein Summary

• Protein general information: Q96AZ6  
  • Name: Interferon stimulated gene 20 kDa protein (EC 3.1.13.1) (Estrogen regulated transcript 45 protein) (Promyelocytic leukemia nuclear body associated protein ISG20)
  • Length: 181  
  • Mass: 20363
  • Tissue specificity: Highly expressed in peripheral blood leukocytes, spleen, thymus, colon and lung. Up regulated by E2 in estrogen receptor-positive breast cancer lines. {ECO
• Sequence:

  MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARL
  EILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHS
  SVEDARATMELYQISQRIRARRGLPRLAVSD

• Structural information:
  • Interpro: IPR013520  IPR012337  IPR036397  
  • PDB: 1WLJ
  • PDBsum: 1WLJ
  • STRING: ENSP00000306565
• Other Databases: GeneCards:  ISG20  Malacards:  ISG20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051607	defense response to virus	IBA	biological process
GO:0045071	negative regulation of viral genome replication	IBA	biological process
GO:0006401	RNA catabolic process	IBA	biological process
GO:0000738	DNA catabolic process, exonucleolytic	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004527	exonuclease activity	IBA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0034511	U3 snoRNA binding	IDA	molecular function
GO:0030620	U2 snRNA binding	IDA	molecular function
GO:0030619	U1 snRNA binding	IDA	molecular function
GO:0015030	Cajal body	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051607	defense response to virus	IMP	biological process
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0004527	exonuclease activity	IMP	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0008859	exoribonuclease II activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0015030	Cajal body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0016605	PML body	IDA	cellular component
GO:0000175	3'-5'-exoribonuclease activity	IDA	molecular function
GO:0009615	response to virus	IDA	biological process
GO:0008310	single-stranded DNA 3'-5' exodeoxyribonuclease activity	IDA	molecular function
GO:0006401	RNA catabolic process	IDA	biological process
GO:0000738	DNA catabolic process, exonucleolytic	IDA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)