• Gene id: 3665

Gene Summary

• Gene Symbol: IRF7   Gene   UCSC   Ensembl
• Aliases: IMD39, IRF-7, IRF-7H, IRF7A, IRF7B, IRF7C, IRF7H
• Gene name: interferon regulatory factor 7
• Alternate names: interferon regulatory factor 7, interferon regulatory factor 7G isoform, interferon regulatory factor-7H,
• Gene location: 11p15.5 (615998: 612554)     Exons: 11     NC_000011.10
• Gene summary(Entrez): IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain g
• OMIM: 603570

Protein Summary

• Protein general information: Q92985  
  • Name: Interferon regulatory factor 7 (IRF 7)
  • Length: 503  
  • Mass: 54278
  • Tissue specificity: Expressed predominantly in spleen, thymus and peripheral blood leukocytes.
• Sequence:

  MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSR
  GGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP
  QGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACA
  GGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
  LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCK
  VYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVL
  VKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA

• Structural information:
  • Interpro: IPR019817  IPR001346  IPR019471  IPR017855  IPR008984   IPR036388  IPR036390  
  • Prosite: PS00601 PS51507
  • CDD: cd00103
  • PDB: 2O61
  • PDBsum: 2O61
  • DIP: 34895
  • STRING: ENSP00000380697
• Other Databases: GeneCards:  IRF7  Malacards:  IRF7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IGI	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0032728	positive regulation of interferon-beta production	IMP	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0002376	immune system process	IBA	biological process
GO:0002819	regulation of adaptive immune response	IDA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:0050776	regulation of immune response	TAS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045655	regulation of monocyte differentiation	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0034127	regulation of MyD88-independent toll-like receptor signaling pathway	ISS	biological process
GO:0034124	regulation of MyD88-dependent toll-like receptor signaling pathway	ISS	biological process
GO:0032608	interferon-beta production	ISS	biological process
GO:0032479	regulation of type I interferon production	TAS	biological process
GO:0019043	establishment of viral latency	TAS	biological process
GO:0009615	response to virus	TAS	biological process
GO:2000110	negative regulation of macrophage apoptotic process	TAS	biological process
GO:0039530	MDA-5 signaling pathway	TAS	biological process
GO:0032728	positive regulation of interferon-beta production	TAS	biological process
GO:0032727	positive regulation of interferon-alpha production	TAS	biological process
GO:0032607	interferon-alpha production	ISS	biological process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological process
GO:0003677	DNA binding	IMP	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0009615	response to virus	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IEA	biological process
GO:0060337	type I interferon signaling pathway	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0034127	regulation of MyD88-independent toll-like receptor signaling pathway	IEA	biological process
GO:0034124	regulation of MyD88-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0032608	interferon-beta production	IEA	biological process
GO:0045351	type I interferon biosynthetic process	IEA	biological process
GO:0032607	interferon-alpha production	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0016064	immunoglobulin mediated immune response	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032727	positive regulation of interferon-alpha production	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051607	defense response to virus	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05162	Measles
hsa04620	Toll-like receptor signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04623	Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq