• Gene id: 366

Gene Summary

• Gene Symbol: AQP9   Gene   UCSC   Ensembl
• Aliases: AQP-9, HsT17287, SSC1, T17287
• Gene name: aquaporin 9
• Alternate names: aquaporin-9, aquaglyceroporin-9, small solute channel 1,
• Gene location: 15q21.3 (58138168: 58185910)     Exons: 7     NC_000015.10
• Gene summary(Entrez): The aquaporins are a family of water-selective membrane channels. This gene encodes a member of a subset of aquaporins called the aquaglyceroporins. This protein allows passage of a broad range of noncharged solutes and also stimulates urea transport and
• OMIM: 602914

Protein Summary

• Protein general information: O43315  
  • Name: Aquaporin 9 (AQP 9) (Aquaglyceroporin 9) (Small solute channel 1)
  • Length: 295  
  • Mass: 31431
  • Tissue specificity: Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen. {ECO
• Sequence:

  MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVA
  GGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFAT
  YPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRL
  FTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM

• Structural information:
  • Interpro: IPR023271  IPR015685  IPR000425  IPR022357  
  • Prosite: PS00221
  • CDD: cd00333
  • STRING: ENSP00000219919
• Other Databases: GeneCards:  AQP9  Malacards:  AQP9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015204	urea transmembrane transporter activity	IBA	molecular function
GO:0015793	glycerol transport	IDA	biological process
GO:0015254	glycerol channel activity	IDA	molecular function
GO:0015250	water channel activity	IDA	molecular function
GO:0006833	water transport	IDA	biological process
GO:0015265	urea channel activity	IMP	molecular function
GO:0071918	urea transmembrane transport	IMP	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0015267	channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015254	glycerol channel activity	EXP	molecular function
GO:0015254	glycerol channel activity	EXP	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006833	water transport	TAS	biological process
GO:0015793	glycerol transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0015722	canalicular bile acid transport	IEA	biological process
GO:0015250	water channel activity	IEA	molecular function
GO:0006833	water transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:1905039	carboxylic acid transmembrane transport	IEA	biological process
GO:1904823	purine nucleobase transmembrane transport	IEA	biological process
GO:0072531	pyrimidine-containing compound transmembrane transport	IEA	biological process
GO:0046689	response to mercury ion	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0015855	pyrimidine nucleobase transport	IDA	biological process
GO:0015837	amine transport	IDA	biological process
GO:0006833	water transport	IDA	biological process
GO:0005350	pyrimidine nucleobase transmembrane transporter activity	IDA	molecular function
GO:0005345	purine nucleobase transmembrane transporter activity	IDA	molecular function
GO:0015250	water channel activity	IDA	molecular function
GO:0010033	response to organic substance	IDA	biological process
GO:0015791	polyol transport	IDA	biological process
GO:0006863	purine nucleobase transport	IDA	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0005372	water transmembrane transporter activity	TAS	molecular function
GO:0071320	cellular response to cAMP	IEP	biological process
GO:0015166	polyol transmembrane transporter activity	TAS	molecular function
GO:0007588	excretion	TAS	biological process
GO:0005275	amine transmembrane transporter activity	TAS	molecular function
GO:0006970	response to osmotic stress	TAS	biological process
GO:0046943	carboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0046942	carboxylic acid transport	TAS	biological process
GO:0030104	water homeostasis	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04976	Bile secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R