• Gene id: 3659

Gene Summary

• Gene Symbol: IRF1   Gene   UCSC   Ensembl
• Aliases: IRF-1, MAR
• Gene name: interferon regulatory factor 1
• Alternate names: interferon regulatory factor 1, interferon regulatory factor 1 isoform +I9, interferon regulatory factor 1 isoform d78, interferon regulatory factor 1 isoform d9,10+, interferon regulatory factor 1 isoform delta4, interferon regulatory factor 1 isoform delta7,
• Gene location: 5q31.1 (132490788: 132481608)     Exons: 10     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a transcriptional regulator and tumor suppressor, serving as an activator of genes involved in both innate and acquired immune responses. The encoded protein activates the transcription of genes involved in the body's r
• OMIM: 617738

Protein Summary

• Protein general information: P10914  
  • Name: Interferon regulatory factor 1 (IRF 1)
  • Length: 325  
  • Mass: 36502
• Sequence:

  MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPK
  TWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSD
  GLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATT
  DEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
  MDATWLDSLLTPVRLPSIQAIPCAP

• Structural information:
  • Interpro: IPR019817  IPR001346  IPR031215  IPR017431  IPR036388   IPR036390  
  • Prosite: PS00601 PS51507
  • CDD: cd00103
  • DIP: 40988
  • STRING: ENSP00000245414
• Other Databases: GeneCards:  IRF1  Malacards:  IRF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0002376	immune system process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0051607	defense response to virus	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0034124	regulation of MyD88-dependent toll-like receptor signaling pathway	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0002819	regulation of adaptive immune response	TAS	biological process
GO:2000564	regulation of CD8-positive, alpha-beta T cell proliferation	ISS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	ISS	biological process
GO:0045590	negative regulation of regulatory T cell differentiation	ISS	biological process
GO:0045088	regulation of innate immune response	TAS	biological process
GO:0032728	positive regulation of interferon-beta production	IMP	biological process
GO:0032481	positive regulation of type I interferon production	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0050776	regulation of immune response	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0034124	regulation of MyD88-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045084	positive regulation of interleukin-12 biosynthetic process	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0010468	regulation of gene expression	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0043374	CD8-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0045590	negative regulation of regulatory T cell differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	IEA	biological process
GO:2000564	regulation of CD8-positive, alpha-beta T cell proliferation	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0035458	cellular response to interferon-beta	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0051607	defense response to virus	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection
hsa04668	TNF signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa05133	Pertussis
hsa04917	Prolactin signaling pathway

Diseases

Associated diseases	References
Asthma	PMID:10225979
Asthma	PMID:16961714
Gastric adenocarcinoma	PMID:9679752
lung non-small cell carcinoma	PMID:10395927
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881