• Gene id: 3658

Gene Summary

• Gene Symbol: IREB2   Gene   UCSC   Ensembl
• Aliases: ACO3, IRE-BP 2, IRE-BP2, IRP2, IRP2AD, NDCAMA
• Gene name: iron responsive element binding protein 2
• Alternate names: iron-responsive element-binding protein 2, iron regulatory protein 2,
• Gene location: 15q25.1 (141636949: 141641076)     Exons: 6     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is an RNA-binding protein that acts to regulate iron levels in the cells by regulating the translation and stability of mRNAs that affect iron homeostasis under conditions when iron is depleted. When iron levels are low, t
• OMIM: 147582

Protein Summary

• Protein general information: P48200  
  • Name: Iron responsive element binding protein 2 (IRE BP 2) (Iron regulatory protein 2) (IRP2)
  • Length: 963  
  • Mass: 105059
• Sequence:

  MDAPKAGYAFEYLIETLNDSSHKKFFDVSKLGTKYDVLPYSIRVLLEAAVRNCDGFLMKKEDVMNILDWKTKQSN
  VEVPFFPARVLLQDFTGIPAMVDFAAMREAVKTLGGDPEKVHPACPTDLTVDHSLQIDFSKCAIQNAPNPGGGDL
  QKAGKLSPLKVQPKKLPCRGQTTCRGSCDSGELGRNSGTFSSQIENTPILCPFHLQPVPEPETVLKNQEVEFGRN
  RERLQFFKWSSRVFKNVAVIPPGTGMAHQINLEYLSRVVFEEKDLLFPDSVVGTDSHITMVNGLGILGWGVGGIE
  TEAVMLGLPVSLTLPEVVGCELTGSSNPFVTSIDVVLGITKHLRQVGVAGKFVEFFGSGVSQLSIVDRTTIANMC
  PEYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRNDQNSSGEPEYSQVIQINLNSIVPSVSGPKR
  PQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEKQKDIVSIHYEGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAG
  LLAKKAVEAGLRVKPYIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEIVGYGCSICVGNTAPLSDAVLNAVKQGD
  LVTCGILSGNKNFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQTEPLGTDPTGKNIYLHDIWPSREEVHRVE
  EEHVILSMFKALKDKIEMGNKRWNSLEAPDSVLFPWDLKSTYIRCPSFFDKLTKEPIALQAIENAHVLLYLGDSV
  TTDHISPAGSIARNSAAAKYLTNRGLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTL
  DVFEAAELYQKEGIPLIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENAD
  SLGLSGRETFSLTFPEELSPGITLNIQTSTGKVFSVIASFEDDVEITLYKHGGLLNFVARKFS

• Structural information:
  • Interpro: IPR015931  IPR001030  IPR015928  IPR006249  IPR018136   IPR036008  IPR000573  IPR029755  
  • Prosite: PS00450 PS01244
  • STRING: ENSP00000258886
• Other Databases: GeneCards:  IREB2  Malacards:  IREB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051539	4 iron, 4 sulfur cluster binding	IBA	molecular function
GO:0006101	citrate metabolic process	IBA	biological process
GO:0006099	tricarboxylic acid cycle	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0030350	iron-responsive element binding	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0003994	aconitate hydratase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030350	iron-responsive element binding	IMP	molecular function
GO:0055072	iron ion homeostasis	IMP	biological process
GO:0006879	cellular iron ion homeostasis	IEA	biological process
GO:0017148	negative regulation of translation	IEA	biological process
GO:0030371	translation repressor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0030350	iron-responsive element binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006879	cellular iron ion homeostasis	TAS	biological process
GO:0034101	erythrocyte homeostasis	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0006879	cellular iron ion homeostasis	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0050892	intestinal absorption	IEA	biological process
GO:0030350	iron-responsive element binding	IEA	molecular function
GO:0030316	osteoclast differentiation	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0006782	protoporphyrinogen IX biosynthetic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0006826	iron ion transport	TAS	biological process
GO:0030350	iron-responsive element binding	TAS	molecular function
GO:0005737	cytoplasm	NAS	cellular component
GO:0003723	RNA binding	TAS	molecular function

Diseases

Associated diseases	References
Alzheimer's disease	PMID:16914832
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray