• Gene id: 3656

Gene Summary

• Gene Symbol: IRAK2   Gene   UCSC   Ensembl
• Aliases: IRAK-2
• Gene name: interleukin 1 receptor associated kinase 2
• Alternate names: interleukin-1 receptor-associated kinase-like 2,
• Gene location: 3p25.3 (74235386: 74544427)     Exons: 25     NC_000001.11
• Gene summary(Entrez): IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of
• OMIM: 603304

Protein Summary

• Protein general information: O43187  
  • Name: Interleukin 1 receptor associated kinase like 2 (IRAK 2)
  • Length: 625  
  • Mass: 69433
  • Tissue specificity: Expressed in spleen, thymus, prostate, lung, liver, skeletal muscle, kidney, pancreas and peripheral blood leukocytes. {ECO
• Sequence:

  MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLV
  DLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQ
  PAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVY
  RGHRHGKPFVFKKLRETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG
  QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCPVNKRSKYTMMKTHLL
  RTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRSPVYLKDLLLSDIPSSTASLCSRKTGVENVM
  AKEICQKYLEKGAGRLPEDCAEALATAACLCLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNT
  PEETDDVDNSSLDASSSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINE
  AKRKLMENILLYKEEKVDSIELFGP

• Structural information:
  • Protein Domains: (13..9-)
    (/note="Death-)
    (210..48-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011029  IPR000488  IPR042151  IPR033611  IPR011009   IPR000719  
  • Prosite: PS50011
  • CDD: cd08795
  • PDB: 3MOP
  • PDBsum: 3MOP
  • DIP: 31800
  • STRING: ENSP00000256458
• Other Databases: GeneCards:  IRAK2  Malacards:  IRAK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0001959	regulation of cytokine-mediated signaling pathway	IEA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0034162	toll-like receptor 9 signaling pathway	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007254	JNK cascade	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043433	negative regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0001959	regulation of cytokine-mediated signaling pathway	IMP	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0070555	response to interleukin-1	IMP	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04722	Neurotrophin signaling pathway

Diseases

Associated diseases	References
Atopic dermatitis	KEGG:H01358
Atopic dermatitis	KEGG:H01358
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)