• Gene id: 3646

Gene Summary

• Gene Symbol: EIF3E   Gene   UCSC   Ensembl
• Aliases: EIF3-P48, EIF3S6, INT6, eIF3-p46
• Gene name: eukaryotic translation initiation factor 3 subunit E
• Alternate names: eukaryotic translation initiation factor 3 subunit E, eIF-3 p48, eukaryotic translation initiation factor 3 subunit 6, eukaryotic translation initiation factor 3 subunit E isoform 2 transcript, eukaryotic translation initiation factor 3, subunit 6 (48kD), euka,
• Gene location: 8q23.1 (108248733: 108201215)     Exons: 13     NC_000008.11
• OMIM: 602210

Protein Summary

• Protein general information: P60228  
  • Name: Eukaryotic translation initiation factor 3 subunit E (eIF3e) (Eukaryotic translation initiation factor 3 subunit 6) (Viral integration site protein INT 6 homolog) (eIF 3 p48)
  • Length: 445  
  • Mass: 52221
  • Tissue specificity: Ubiquitously expressed. Expressed at highest levels in appendix, lymph, pancreas, skeletal muscle, spleen and thymus. {ECO
• Sequence:

  MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRT
  TVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEY
  LYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNH
  PKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY
  VNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLI
  RNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

• Structural information:
  • Protein Domains: (221..39-)
    (/note="PCI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01185"-)
  • Interpro: IPR016650  IPR019010  IPR000717  IPR036388  IPR036390  
  • Prosite: PS50250
  • PDB: 3J8B 3J8C 6FEC
  • PDBsum: 3J8B 3J8C 6FEC
  • DIP: 32691
  • STRING: ENSP00000220849
• Other Databases: GeneCards:  EIF3E  Malacards:  EIF3E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0045727	positive regulation of translation	IPI	biological process
GO:1902416	positive regulation of mRNA binding	IPI	biological process
GO:0006413	translational initiation	IBA	biological process
GO:0005852	eukaryotic translation initiation factor 3 complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003743	translation initiation factor activity	IC	molecular function
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003743	translation initiation factor activity	IDA	contributes to
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0006446	regulation of translational initiation	NAS	biological process
GO:0005654	nucleoplasm	NAS	cellular component
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005852	eukaryotic translation initiation factor 3 complex	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006413	translational initiation	IEA	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0005852	eukaryotic translation initiation factor 3 complex	IEA	cellular component
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0033290	eukaryotic 48S preinitiation complex	IEA	cellular component
GO:0002183	cytoplasmic translational initiation	IEA	biological process
GO:0016282	eukaryotic 43S preinitiation complex	IEA	cellular component
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0071540	eukaryotic translation initiation factor 3 complex, eIF3e	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001732	formation of cytoplasmic translation initiation complex	IEA	biological process
GO:0003743	translation initiation factor activity	IDA	contributes to
GO:0003743	translation initiation factor activity	IC	contributes to
GO:0003743	translation initiation factor activity	IC	contributes to
GO:0016605	PML body	IDA	colocalizes with
GO:0006413	translational initiation	IC	biological process
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006413	translational initiation	IDA	biological process
GO:0006413	translational initiation	IC	biological process
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0006446	regulation of translational initiation	NAS	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IMP	biological process
GO:0005852	eukaryotic translation initiation factor 3 complex	NAS	cellular component
GO:0000785	chromatin	NAS	colocalizes with
GO:0016020	membrane	HDA	cellular component
GO:0045947	negative regulation of translational initiation	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa05160	Hepatitis C

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)