• Gene id: 3645

Gene Summary

• Gene Symbol: INSRR   Gene   UCSC   Ensembl
• Aliases: IRR
• Gene name: insulin receptor related receptor
• Alternate names: insulin receptor-related protein, IR-related receptor,
• Gene location: 1q23.1 (156859116: 156840062)     Exons: 22     NC_000001.11
• OMIM: 602059

Protein Summary

• Protein general information: P14616  
  • Name: Insulin receptor related protein (IRR) (EC 2.7.10.1) (IR related receptor) [Cleaved into: Insulin receptor related protein alpha chain; Insulin receptor related protein beta chain]
  • Length: 1297  
  • Mass: 143720
• Sequence:

  MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLMFTATGEDFRGLSFPR
  LTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEMPHLRDVALPALGAVLRGAVRVEKNQELCHL
  STIDWGLLQPAPGANHIVGNKLGEECADVCPGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPCPHGMACTAR
  GECCHTECLGGCSQPEDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSC
  LAQCPSGFTRNSSSIFCHKCEGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQGYNLEPQLQHSLGLV
  ETITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQNLQQLGSWVAAGLTIPVGKIYFAFNPRLCL
  EHIYRLEEVTGTRGRQNKAEINPRTNGDRAACQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESP
  FQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRT
  LPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRGLRLPTSNNDPRFDGE
  DGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGP
  LRLGGNSSDFEIQEDKVPRERAVLSGLRHFTEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWE
  ASSKNSVLLRWLEPPDPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGS
  WTDSVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTLYASVNPEYFSASDMYVPDEWEVP
  REQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELASPRECIEFLKEASVMKAFKCHHVVRLLGVVS
  QGQPTLVIMELMTRGDLKSHLRSLRPEAENNPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQ
  DFTVKIGDFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ
  VLKFVMDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFYYSPECRGARGSLPTT
  DAEPDSSPTPRDCSPQNGGPGH

• Structural information:
  • Protein Domains: (483..60-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (607..70-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (818..91-)
    3 (/note="Fibronectin-type-III)
    (/e-)
  • Interpro: IPR003961  IPR036116  IPR006211  IPR006212  IPR009030   IPR013783  IPR028792  IPR011009  IPR000719  IPR017441  IPR000494  IPR036941  IPR001245  IPR008266  IPR020635  IPR016246  IPR002011  
  • Prosite: PS50853 PS00107 PS50011 PS00109 PS00239
  • CDD: cd00063 cd00064
  • STRING: ENSP00000357178
• Other Databases: GeneCards:  INSRR  Malacards:  INSRR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0005009	insulin-activated receptor activity	IBA	molecular function
GO:0005899	insulin receptor complex	IBA	cellular component
GO:0030424	axon	IBA	cellular component
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0043560	insulin receptor substrate binding	IBA	molecular function
GO:0048856	anatomical structure development	IBA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IDA	molecular function
GO:0071469	cellular response to alkaline pH	IDA	biological process
GO:0031532	actin cytoskeleton reorganization	IDA	biological process
GO:0046777	protein autophosphorylation	IMP	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0043548	phosphatidylinositol 3-kinase binding	IEA	molecular function
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0043560	insulin receptor substrate binding	IEA	molecular function
GO:0071469	cellular response to alkaline pH	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0043235	receptor complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0071469	cellular response to alkaline pH	IEA	biological process
GO:0030238	male sex determination	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	NAS	molecular function
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	NAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa05215	Prostate cancer

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq