• Gene id: 3633

Gene Summary

• Gene Symbol: INPP5B   Gene   UCSC   Ensembl
• Aliases: 5PTase
• Gene name: inositol polyphosphate-5-phosphatase B
• Alternate names: type II inositol 1,4,5-trisphosphate 5-phosphatase, inositol polyphosphate-5-phosphatase, 75kDa, phosphoinositide 5-phosphatase,
• Gene location: 1p34.3 (37947094: 37860696)     Exons: 32     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of a family of inositol polyphosphate-5-phosphatases. These enzymes function in the regulation of calcium signaling by inactivating inositol phosphates. The encoded protein is localized to the cytosol and mitochondria, and assoc
• OMIM: 601232

Protein Summary

• Protein general information: P32019  
  • Name: Type II inositol 1,4,5 trisphosphate 5 phosphatase (EC 3.1.3.36) (75 kDa inositol polyphosphate 5 phosphatase) (Phosphoinositide 5 phosphatase) (5PTase)
  • Length: 993  
  • Mass: 112852
  • Tissue specificity: Platelets.
• Sequence:

  MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPV
  SRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRMFLHEVARACPGFDSATRDPEFLWLSRYRCA
  ELELEMPTPRGCNSALVTWPGYATIGGGRYPSRKKRWGLEEARPQGAGSVLFWGGAMEKTGFRLMERAHGGGFVW
  GRSARDGRRDEELEEAGREMSAAAGSRERNTAGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITD
  MVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPD
  VYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAYISEVEAETVG
  TGIMGRMGNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSRMQFCQPDPSLPPLTISNHDVILWL
  GDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAP
  AWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVRSLDKMENANIPSVSLSKR
  EFCFQNVKYMQLKVESFTIHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVNKMTATKL
  NSGEDKIEDILVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILDLPLETISELTLMPVWTGDDGSQLDS
  PMEIPKELWMMVDYLYRNAVQQEDLFQQPGLRSEFEHIRDCLDTGMIDNLSASNHSVAEALLLFLESLPEPVICY
  STYHNCLECSGNYTASKQVISTLPIFHKNVFHYLMAFLRELLKNSAKNHLDENILASIFGSLLLRNPAGHQKLDM
  TEKKKAQEFIHQFLCNPL

• Structural information:
  • Protein Domains: (22..14-)
    (/note="PH-)
    (821..99-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172"-)
  • Interpro: IPR036691  IPR005135  IPR013783  IPR031896  IPR000300   IPR037793  IPR008936  IPR000198  
  • Prosite: PS50238
  • CDD: cd09093 cd13383
  • PDB: 3MTC 3N9V 4CML 5A7I 5A7J
  • PDBsum: 3MTC 3N9V 4CML 5A7I 5A7J
  • STRING: ENSP00000362115
• Other Databases: GeneCards:  INPP5B  Malacards:  INPP5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004439	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0046856	phosphatidylinositol dephosphorylation	IBA	biological process
GO:0052658	inositol-1,4,5-trisphosphate 5-phosphatase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0046855	inositol phosphate dephosphorylation	IBA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0052658	inositol-1,4,5-trisphosphate 5-phosphatase activity	IDA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0004439	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0052745	inositol phosphate phosphatase activity	IEA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004439	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0070613	regulation of protein processing	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0052658	inositol-1,4,5-trisphosphate 5-phosphatase activity	IEA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004439	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IEA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0004439	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0046856	phosphatidylinositol dephosphorylation	IBA	biological process
GO:0052658	inositol-1,4,5-trisphosphate 5-phosphatase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0046855	inositol phosphate dephosphorylation	IBA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0052658	inositol-1,4,5-trisphosphate 5-phosphatase activity	IDA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0004439	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0052745	inositol phosphate phosphatase activity	IEA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004439	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0070613	regulation of protein processing	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0052658	inositol-1,4,5-trisphosphate 5-phosphatase activity	IEA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004439	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IEA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray