Male Infertility Database

Search Result

Gene id

3632

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

INPP5A Gene UCSC Ensembl

Aliases

5PTASE

Gene name

inositol polyphosphate-5-phosphatase A

Alternate names

inositol polyphosphate-5-phosphatase A, 43 kDa inositol polyphosphate 5-phophatase, 43 kDa inositol polyphosphate 5-phosphatase, CTCL tumor antigen HD-CL-02, InsP3 5-phosphatase, inositol polyphosphate-5-phosphatase, 40kD, inositol polyphosphate-5-phosphatase, ,

Gene location

10q26.3 (1226453: 1221650) Exons: 7 NC_000016.10

Gene summary(Entrez)

The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses

OMIM

600106

Protein Summary

Protein general information

Q14642

Name: Inositol polyphosphate 5 phosphatase A (EC 3.1.3.56) (43 kDa inositol polyphosphate 5 phosphatase) (Type I inositol 1,4,5 trisphosphate 5 phosphatase) (5PTase)

Length: 412 Mass: 47820

Tissue specificity: Predominantly expressed in heart, brain, and skeletal muscle (PubMed

Sequence

MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKEL
LSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEK
FPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKV
SYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGT
ALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRSESEEKVVTYDH
IGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ

Structural information

Interpro:	IPR036691 IPR005135 IPR039737 IPR000300
MINT:
STRING:	ENSP00000357583

Other Databases

GeneCards: INPP5A Malacards: INPP5A

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0046855	inositol phosphate dephos phorylation	IBA	biological process
GO:0048016	inositol phosphate-mediat ed signaling	IBA	biological process
GO:0004445	inositol-polyphosphate 5- phosphatase activity	IBA	molecular function
GO:0004445	inositol-polyphosphate 5- phosphatase activity	IEA	molecular function
GO:0046856	phosphatidylinositol deph osphorylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0052659	inositol-1,3,4,5-tetrakis phosphate 5-phosphatase a ctivity	IEA	molecular function
GO:0004445	inositol-polyphosphate 5- phosphatase activity	IEA	molecular function
GO:0052658	inositol-1,4,5-trisphosph ate 5-phosphatase activit y	IEA	molecular function
GO:0046855	inositol phosphate dephos phorylation	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0004445	inositol-polyphosphate 5- phosphatase activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0043647	inositol phosphate metabo lic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042731	PH domain binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	NAS	cellular component
GO:0004445	inositol-polyphosphate 5- phosphatase activity	NAS	molecular function

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04910	Insulin signaling pathway
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 26361204
Embryo quality	MIK: 26361204
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
31037746	Spermatoge nic defect s	28 men with az oospermia	Male infertility	Microarray	Show abstract
25753583	Unexplaine d infertil ity	46 (17 fertile men, 29 male pa tients)	Male infertility	Microarray	Show abstract
26361204	Male infer tility, Em bryo quali ty	181 (127 men un dergoing IVF tr eatment, 54 nor mozoospermic, f ertile men)	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All