• Gene id: 3628

Gene Summary

• Gene Symbol: INPP1   Gene   UCSC   Ensembl
• Gene name: inositol polyphosphate-1-phosphatase
• Alternate names: inositol polyphosphate 1-phosphatase, IPP, IPPase,
• Gene location: 2q32.2 (190343588: 190371664)     Exons: 9     NC_000002.12
• Gene summary(Entrez): This gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisp
• OMIM: 614264

Protein Summary

• Protein general information: P49441  
  • Name: Inositol polyphosphate 1 phosphatase (IPP) (IPPase) (EC 3.1.3.57)
  • Length: 399  
  • Mass: 43998
  • Tissue specificity: Ubiquitously expressed, with highest levels in pancreas and kidney.
• Sequence:

  MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFPGLEKN
  IFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTEINVPQDILGI
  WVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGVPLMGVINQPFVSRDPNTLRWKGQCYWGLSY
  MGTNMHSLQLTISRRNGSETHTGNTGSEAAFSPSFSAVISTSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQG
  LVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAY
  RSRKRLETFLSLLVQNLAPAETHT

• Structural information:
  • Interpro: IPR020583  IPR000760  IPR020550  
  • Prosite: PS00629 PS00630
  • STRING: ENSP00000376142
• Other Databases: GeneCards:  INPP1  Malacards:  INPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046855	inositol phosphate dephosphorylation	IBA	biological process
GO:0004441	inositol-1,4-bisphosphate 1-phosphatase activity	IBA	molecular function
GO:0046855	inositol phosphate dephosphorylation	IEA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004441	inositol-1,4-bisphosphate 1-phosphatase activity	TAS	molecular function
GO:0006796	phosphate-containing compound metabolic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004441	inositol-1,4-bisphosphate 1-phosphatase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R