• Gene id: 3627

Gene Summary

• Gene Symbol: CXCL10   Gene   UCSC   Ensembl
• Aliases: C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1
• Gene name: C-X-C motif chemokine ligand 10
• Alternate names: C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, gamma IP10, interferon-inducible cytokine IP-10, protein 10 from interferon (gamma)-induced cell line, small inducible cytokine subfamily B (Cys-X-Cys), member 10, small-inducible cytokine B10,
• Gene location: 4q21.1 (8433608: 8752960)     Exons: 3     NC_000007.14
• Gene summary(Entrez): This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of
• OMIM: 600324

Protein Summary

• Protein general information: P02778  
  • Name: C X C motif chemokine 10 (10 kDa interferon gamma induced protein) (Gamma IP10) (IP 10) (Small inducible cytokine B10) [Cleaved into: CXCL10(1 73)]
  • Length: 98  
  • Mass: 10881
  • Tissue specificity: Mainly secreted by monocytes, endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus (PubMed
• Sequence:

  MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCL
  NPESKAIKNLLKAVSKERSKRSP

• Structural information:
  • Interpro: IPR001089  IPR018048  IPR001811  IPR033899  IPR036048  
  • Prosite: PS00471
  • CDD: cd00273
  • PDB: 1LV9 1O7Y 1O7Z 1O80
  • PDBsum: 1LV9 1O7Y 1O7Z 1O80
  • DIP: 5893
  • STRING: ENSP00000305651
• Other Databases: GeneCards:  CXCL10  Malacards:  CXCL10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901509	regulation of endothelial tube morphogenesis	IDA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:0010819	regulation of T cell chemotaxis	IDA	biological process
GO:0042118	endothelial cell activation	IGI	biological process
GO:0045236	CXCR chemokine receptor binding	IBA	molecular function
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0048248	CXCR3 chemokine receptor binding	IDA	molecular function
GO:0042127	regulation of cell population proliferation	IDA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0006935	chemotaxis	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0008603	cAMP-dependent protein kinase regulator activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0008015	blood circulation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007517	muscle organ development	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:2000406	positive regulation of T cell migration	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034605	cellular response to heat	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0010996	response to auditory stimulus	IEA	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0002690	positive regulation of leukocyte chemotaxis	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0045662	negative regulation of myoblast differentiation	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0033280	response to vitamin D	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:1901740	negative regulation of myoblast fusion	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:2000479	regulation of cAMP-dependent protein kinase activity	IEA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IMP	biological process
GO:0008201	heparin binding	IMP	molecular function
GO:0010818	T cell chemotaxis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa05169	Epstein-Barr virus infection
hsa05164	Influenza A
hsa05160	Hepatitis C
hsa04668	TNF signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04620	Toll-like receptor signaling pathway
hsa04657	IL-17 signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04623	Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
Pelvic endometriosis	INFBASE: 26871558
Female infertility	INFBASE: 26871558
Allergic rhinitis	KEGG:H01360
Allergic rhinitis	KEGG:H01360
pulmonary sarcoidosis	PMID:9834133
pulmonary sarcoidosis	PMID:17550373
Thoracic aortic aneurysm	PMID:16014397
Bronchiolitis obliterans	PMID:12097412
Asthma	PMID:16602032
Severe acute respiratory syndrome	PMID:17052299
Interstitial lung disease	PMID:19565490
Chronic obstructive pulmonary disease	PMID:17925429
Cerebral infarction	PMID:10825390
systemic scleroderma	PMID:21303517
Coronary restenosis	PMID:14578618
Myasthenia gravis	PMID:15843529
Diabetic retinopathy	PMID:17194635
type 2 diabetes mellitus	PMID:19187771
Pulmonary emphysema	PMID:15526056
type 1 diabetes mellitus	PMID:19046227
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R