• Gene id: 3624

Gene Summary

• Gene Symbol: INHBA   Gene   UCSC   Ensembl
• Aliases: EDF, FRP
• Gene name: inhibin beta A subunit
• Alternate names: inhibin beta A chain, FSH-releasing protein, Inhibin, beta-1, activin beta-A chain, erythroid differentiation factor, erythroid differentiation protein, follicle-stimulating hormone-releasing protein, inhibin, beta A (activin A, activin AB alpha polypepti,
• Gene location: 7p14.1 (41710531: 41685100)     Exons: 7     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activa
• OMIM: 147290

Protein Summary

• Protein general information: P08476  
  • Name: Inhibin beta A chain (Activin beta A chain) (Erythroid differentiation protein) (EDF)
  • Length: 426  
  • Mass: 47,442
• Sequence:

  MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVT
  QPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEISKEGSDLSVV
  ERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSS
  SIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQS
  EDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINH
  YRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS

• Structural information:
  • Interpro: IPR029034  IPR000491  IPR001839  IPR001111  IPR015615   IPR017948  
  • Prosite: PS00250 PS51362
  • PDB: 1NYS 1NYU 1S4Y 2ARP 2ARV 2B0U 2P6A 3B4V 4MID 5HLY 5HLZ
  • PDBsum: 1NYS 1NYU 1S4Y 2ARP 2ARV 2B0U 2P6A 3B4V 4MID 5HLY 5HLZ
  • DIP: 5824
  • STRING: ENSP00000242208
• Other Databases: GeneCards:  INHBA  Malacards:  INHBA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitotic cell cycle	IDA	biological process
GO:0001541	ovarian follicle development	IGI	biological process
GO:0001541	ovarian follicle development	NAS	biological process
GO:0001942	hair follicle development	IGI	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0005160	transforming growth factor beta receptor binding	IBA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0006952	defense response	TAS	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007399	nervous system development	NAS	biological process
GO:0008083	growth factor activity	TAS	molecular function
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008584	male gonad development	IGI	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0021773	striatal medium spiny neuron differentiation	IDA	biological process
GO:0030154	cell differentiation	TAS	biological process
GO:0030218	erythrocyte differentiation	NAS	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0032270	positive regulation of cellular protein metabolic process	IDA	biological process
GO:0032924	activin receptor signaling pathway	IDA	biological process
GO:0034711	inhibin binding	IEA	molecular function
GO:0035987	endodermal cell differentiation	IDA	biological process
GO:0040007	growth	IEA	biological process
GO:0042326	negative regulation of phosphorylation	TAS	biological process
GO:0042476	odontogenesis	IGI	biological process
GO:0042493	response to drug	IDA	biological process
GO:0042541	hemoglobin biosynthetic process	IDA	biological process
GO:0042701	progesterone secretion	IGI	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0043408	regulation of MAPK cascade	IBA	biological process
GO:0043509	activin A complex	IDA	cellular component
GO:0043512	inhibin A complex	IDA	cellular component
GO:0045077	negative regulation of interferon-gamma biosynthetic process	TAS	biological process
GO:0045578	negative regulation of B cell differentiation	TAS	biological process
GO:0045648	positive regulation of erythrocyte differentiation	IDA	biological process
GO:0045650	negative regulation of macrophage differentiation	TAS	biological process
GO:0045786	negative regulation of cell cycle	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046880	regulation of follicle-stimulating hormone secretion	IGI	biological process
GO:0046881	positive regulation of follicle-stimulating hormone secretion	TAS	biological process
GO:0046882	negative regulation of follicle-stimulating hormone secretion	NAS	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0048333	mesodermal cell differentiation	IEA	biological process
GO:0048468	cell development	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0060021	palate development	IGI	biological process
GO:0060279	positive regulation of ovulation	ISS	biological process
GO:0060395	SMAD protein signal transduction	IBA	biological process
GO:0061029	eyelid development in camera-type eye	ISS	biological process
GO:0070699	type II activin receptor binding	IPI	molecular function
GO:0071372	cellular response to follicle-stimulating hormone stimulus	IEA	biological process
GO:0071397	cellular response to cholesterol	IEA	biological process
GO:0097154	GABAergic neuron differentiation	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IDA	biological process
GO:0001541	ovarian follicle development	IGI	biological process
GO:0001541	ovarian follicle development	NAS	biological process
GO:0001707	mesoderm formation	IEA	biological process
GO:0001942	hair follicle development	IGI	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological process
GO:0005102	receptor binding	IEA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005160	transforming growth factor beta receptor binding	IBA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0006952	defense response	TAS	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007399	nervous system development	NAS	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	TAS	molecular function
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008584	male gonad development	IGI	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0021773	striatal medium spiny neuron differentiation	IDA	biological process
GO:0030154	cell differentiation	TAS	biological process
GO:0030218	erythrocyte differentiation	NAS	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0032270	positive regulation of cellular protein metabolic process	IDA	biological process
GO:0032924	activin receptor signaling pathway	IDA	biological process
GO:0034711	inhibin binding	IEA	molecular function
GO:0035987	endodermal cell differentiation	IDA	biological process
GO:0040007	growth	IEA	biological process
GO:0042326	negative regulation of phosphorylation	TAS	biological process
GO:0042476	odontogenesis	IGI	biological process
GO:0042493	response to drug	IDA	biological process
GO:0042541	hemoglobin biosynthetic process	IDA	biological process
GO:0042701	progesterone secretion	IGI	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0043408	regulation of MAPK cascade	IBA	biological process
GO:0043509	activin A complex	IDA	cellular component
GO:0043512	inhibin A complex	IEA	cellular component
GO:0043512	inhibin A complex	IDA	cellular component
GO:0045077	negative regulation of interferon-gamma biosynthetic process	TAS	biological process
GO:0045578	negative regulation of B cell differentiation	TAS	biological process
GO:0045648	positive regulation of erythrocyte differentiation	IDA	biological process
GO:0045650	negative regulation of macrophage differentiation	TAS	biological process
GO:0045786	negative regulation of cell cycle	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046880	regulation of follicle-stimulating hormone secretion	IGI	biological process
GO:0046881	positive regulation of follicle-stimulating hormone secretion	TAS	biological process
GO:0046882	negative regulation of follicle-stimulating hormone secretion	NAS	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0048333	mesodermal cell differentiation	IEA	biological process
GO:0048468	cell development	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0060021	palate development	IGI	biological process
GO:0060279	positive regulation of ovulation	IEA	biological process
GO:0060279	positive regulation of ovulation	ISS	biological process
GO:0060395	SMAD protein signal transduction	IBA	biological process
GO:0061029	eyelid development in camera-type eye	IEA	biological process
GO:0061029	eyelid development in camera-type eye	ISS	biological process
GO:0070699	type II activin receptor binding	IPI	molecular function
GO:0071372	cellular response to follicle-stimulating hormone stimulus	IEA	biological process
GO:0071397	cellular response to cholesterol	IEA	biological process
GO:0097154	GABAergic neuron differentiation	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IDA	biological process
GO:0001541	ovarian follicle development	IGI	biological process
GO:0001541	ovarian follicle development	NAS	biological process
GO:0001942	hair follicle development	IGI	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0005160	transforming growth factor beta receptor binding	IBA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0006952	defense response	TAS	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007399	nervous system development	NAS	biological process
GO:0008083	growth factor activity	TAS	molecular function
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008584	male gonad development	IGI	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0021773	striatal medium spiny neuron differentiation	IDA	biological process
GO:0030154	cell differentiation	TAS	biological process
GO:0030218	erythrocyte differentiation	NAS	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0032270	positive regulation of cellular protein metabolic process	IDA	biological process
GO:0032924	activin receptor signaling pathway	IDA	biological process
GO:0035987	endodermal cell differentiation	IDA	biological process
GO:0042326	negative regulation of phosphorylation	TAS	biological process
GO:0042476	odontogenesis	IGI	biological process
GO:0042493	response to drug	IDA	biological process
GO:0042541	hemoglobin biosynthetic process	IDA	biological process
GO:0042701	progesterone secretion	IGI	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0043408	regulation of MAPK cascade	IBA	biological process
GO:0043509	activin A complex	IDA	cellular component
GO:0043512	inhibin A complex	IDA	cellular component
GO:0045077	negative regulation of interferon-gamma biosynthetic process	TAS	biological process
GO:0045578	negative regulation of B cell differentiation	TAS	biological process
GO:0045648	positive regulation of erythrocyte differentiation	IDA	biological process
GO:0045650	negative regulation of macrophage differentiation	TAS	biological process
GO:0045786	negative regulation of cell cycle	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046880	regulation of follicle-stimulating hormone secretion	IGI	biological process
GO:0046881	positive regulation of follicle-stimulating hormone secretion	TAS	biological process
GO:0046882	negative regulation of follicle-stimulating hormone secretion	NAS	biological process
GO:0048468	cell development	IBA	biological process
GO:0060021	palate development	IGI	biological process
GO:0060279	positive regulation of ovulation	ISS	biological process
GO:0060395	SMAD protein signal transduction	IBA	biological process
GO:0061029	eyelid development in camera-type eye	ISS	biological process
GO:0070699	type II activin receptor binding	IPI	molecular function
GO:0097154	GABAergic neuron differentiation	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04550	Signaling pathways regulating pluripotency of stem cells

Diseases

Associated diseases	References
Cancer	GAD: 19064572
Cancer (colorectal)	GAD: 20610541
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (ovarian)	GAD: 20628624
Cancer (prostate)	GAD: 19574343
Cancer (breast)	GAD: 20634197
Cleft defects	GAD: 20634891
Obesity	GAD: 21102462
Amyotrophic lateral sclerosis (ALS)	GAD: 18608101
Psychological disorders	GAD: 19086053
Several psychiatric disorders	GAD: 19086053
Endometriosis	INFBASE: 10735596
Amenorrhoea	INFBASE: 21627557
Premature ovarian insufficiency (POI)	INFBASE: 18211971
Hyperprolactinemia	INFBASE: 21737073
Primary and secondary Sertoli-cell-only (SCO) syndrome	INFBASE: 15950666
Secondary oligoamenorrhea	INFBASE: 21737073
Decreased ovarian reserve (DOR)	INFBASE: 25176102
Endometriosis	INFBASE: 10899494
Female infertility	INFBASE: 9806293
Follicular development	INFBASE: 12877256
Functional state of the seminiferous epithelium in patients with azoospermia	INFBASE: 12466362
Constitutional delay of growth and puberty	INFBASE: 26266675
Luteal phase defect	INFBASE: 2506214
Fertilizing defects	INFBASE: 16650414
Female infertility	INFBASE: 19386982
Polycystic ovary syndrome (PCOS)	INFBASE: 11297588
Ovarian dysfunction	INFBASE: 18959173
Ovarian endometriosis	INFBASE: 19956897
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 24455972
Ovarian reserve	INFBASE: 16277899
Premature ovarian failure (POF)	INFBASE: 19066296
Ovarian response	INFBASE: 16831355
Oocyte quantity	INFBASE: 16650414
MRKH syndrome (congenital uterus and vaginal aplasia)	INFBASE: 19101883
Oocyte quantity	INFBASE: 10561002
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 10686192
Unexplained infertility	INFBASE: 10783349
Unexplained infertility	INFBASE: 10735596
Tubal damage	INFBASE: 10735596
Male factor infertility	MIK: 16764873
Congenital hypogonadotropic hypogonadism (CHH)	MIK: 20980953
Cryptorchidism	MIK: 11397857
Disorders of spermatogenesis	MIK: 11275954
Male factor infertility	MIK: 24752115
Gonadal dysfunction	MIK: 10927037
Male factor infertility	MIK: 18154424
Teratozoospermia	MIK: 25740852
Varicocele	MIK: 21285453
Hypogonadotropic hypogonadism	MIK: 26266675
Non obstructive azoospermia	MIK: 16266395
Male factor infertility	MIK: 20826577
Oligoazoospermia	MIK: 12554256
Male subfertility	MIK: 9875694
Infertility	MIK: 7659145
Male gonadal dysfunction	MIK: 12466353
Azoospermia	MIK: 12721183
Male reproductive failures	MIK: 16649411
Azoospermia	MIK: 9619549
Male factor infertility	MIK: 12721183
Non obstructive azoospermia	MIK: 17462637
Male factor infertility	MIK: 12554256
Sertoli cell only syndrome (SCOS)	MIK: 24752115
Sertoli cell only syndrome (SCOS)	MIK: 15551748
Spermatogenesis defects	MIK: 11397833
Oligozoospermia	MIK: 7659145
Testicular spermatogenesis	MIK: 18154424
Spermatogenesis defects	MIK: 21104644
Varicocele	MIK: 15163341
Spermatogenesis defects	MIK: 9745412
Oligozoospermia	MIK: 1860676
Presence of sperm in azoospermic patients	MIK: 11963224
Spermatogenesis defects	MIK: 16483151
Male factor infertility	MIK: 11963224
Male factor infertility	MIK: 11397833
Spermatogenesis defects	MIK: 24752115
Hypothalamic amenorrhea	INFBASE: 9806574
Hypogonadotropic hypogonadism	INFBASE: 21737073
Asthenozoospermia	MIK: 25269872
Asthenozoospermia	MIK: 25740852
Hypospermatogenesis	MIK: 24752115
Azoospermia	MIK: 18477551
Azoospermia	MIK: 15950666
Asthenozoospermia	MIK: 25269872
Azoospermia	MIK: 12399529
Sertoli cell only syndrome	MIK: 24752115
Hypospermatogenesis	MIK: 24752115
Spermatogenic maturation arrest	MIK: 24752115
Testicular spermatogenesis	MIK: 18154424
Congenital hypogonadotropic hypogonadism	MIK: 20980953
Contributes to establishing the balance between Sertoli and germ cell number that is ultimately required for adult male fertility	MIK: 20926807
Cryptorchidism	MIK: 12807515
Spermatogenic defects	MIK: 11275954
Nonobstructive azoospermia	MIK: 17462637
Functional state of the seminiferous epithelium in patients with azoospermia	MIK: 12466362
Gonadal dysfunction	MIK: 10927037
Hypogonadotropic hypogonadism	MIK: 20826577
Constitutional delay of growth and puberty	MIK: 26266675
Hypospermatogenesis	MIK: 28361989
Azoospermia	MIK: 7659145
Oligozoospermia	MIK: 7659145
Male gonadal dysfunction	MIK: 12466353
Male infertility	MIK: 14574812
Varicocele	MIK: 21285453
Nonobstructive azoospermia	MIK: 16755869
Oligoazoospermia	MIK: 12554256
Teratozoospermia,	MIK: 25740852
Ovarian endometriosis	MIK: 19956897
Presence of sperm in azoospermic patients	MIK: 11963224
Impaired spermatogenesis	MIK: 16483151

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15163341	Varicocele			112 (7 prepubertal and 55 pubertal boys with untreated grade II or III varicocele, 7 prepubertal and 43 pubertal normal boys were considered as controls)	Male infertility	inhibin B and Pro-alphaC and AMH
20923279	Non-obstructive azoospermia, male subfertility			54 (37 with NOA, 17 fertile controls)	Male infertility
26266675	Hypogonadotropic hypogonadism, constitutional delay of growth and puberty			74 (24 boys were diagnosed with HH, 22 boys with CDGP, pre-pubertal (PP CDGP) at referral and 28 boys with CDGP)	Male infertility	Inhibin B AMH INSL3 IGF1 IGFBP3 and DHEAS
18477551	Azoospermia			82 (51 men with azoospermia, 31 controls)	Male infertility
11397857	Cryptorchidism				Male infertility
11397833	Spermatogenetic defects, Male infertility	Yq microdeletions		102 infertile (27 had Yq microdeletions, 75 were classified as idiopathic infertiles)	Male infertility
10468940	Azoospermia			119 (89 azoospermic, 30 normozoospermic)	Male infertility
20826577	Hypogonadotropic hypogonadism			82 (16 had IHH, 15 congenital HH within CPHD, and 51 CDP)	Male infertility
20980953	Congenital hypogonadotropic hypogonadism (HH)			67 (39 with constitutional pubertal delay, 15 isolated HH, 13pituitary stalk interruption syndrome without HH)	Male infertility
10927037	Gonadal dysfunction			44 (16 with primary testicular failure, 10 with partial idiopathic hypogonadotropic hypogonadism (IHH), 8 with primary germ cell failure, one with iatrogenic hypogonadotropic hypogonadism, one with untreated Kallmann's syndrome, and 8 healthy fertile cont	Male infertility
16649411	Male reproductive failures			411 (355 men with normal levels of FSH, LH and testosterone, 56 controls)	Male infertility
21285453	Male subfertility, varicocele			92 (61 subfertile men with varicocele, 31 fertile controls)	Male infertility
20980953	Congenitalhypogonadotropic hypogonadism			67 (39 diagnosed with constitutional pubertal delay, 15 isolated HH, pituitary stalk interruption syndrome (3a with [n=5] and 3b [n=8] without HH)	Male infertility	AMH inhibinB
20172518	Nonobstructive azoospermia			139 men	Male infertility	AMH inhibin B
18321497	Azoospermia			82 (51 men with azoospermia, 31 controls)	Male infertility	FSH INHB AMH
17462637	Disorders of spermatogenesis, nonobstructive azoospermia				Male infertility	AMH INHB
17298717	Male factor infertility, non-male factor infertility			129 (66 male factor infertility, non- male factor infertility)	Male infertility	AMH INHB
15163341	Varicocele			112 (7 prepubertal and 55 pubertal boys with untreated grade II or III varicocele, 7 prepubertal and 43 pubertal normal boys were considered as controls)	Male infertility	inhibin B and Pro-alphaC and AMH
15551748	Sertoli cell only syndrome (SCO), Oligozoospermia			49 (10 azoospermic patients, 39 oligozoospermic men)	Male infertility
25740852	Oligozoospermia, asthenozoospermia, teratozoospermia,			818 (377 were normozoospermic (reference group), 441 presented at least one abnormal semen parameter (case group))	Male infertility
25345944	Azoospermia			262 (162 azoospermic patients with normal FSH levels, 100 azoospermic patients with abnormal FSH levels)	Male infertility
25269872	Asthenozoospermia			153 (52 normal, 55 high sperm count, 23 asthenozoospermia, 23 oligozoospermia)	Male infertility	AMH inhibin B
24752115	Azoospermia, Sertoli cell only, Hypospermatogenesis, spermatogenic maturation arrest (complete or incomplete)			95 (20 patients of Sertoli cell only, 25 of hypospermatogenesis, 18 of spermatogenic maturation arrest (complete or incomplete), 32 of normal spermatogenesis)	Male infertility
24527536	Varicocele, male infertility			150 (95 infertile varicoceleVC patients, 55 normal fertile men)	Male infertility
16266395	Nonobstructive azoospermia			51 (46 nonobstructive azoospermia, 5 control fertile men)	Male infertility	inhibin B FSH
14574812	Male infertility			82 (20 fertile, 20 oligospermia, 22 asthenospermia, 20 non-obstructive azoospermia(NOA))	Male infertility	INHB
12466362	Functional state of the seminiferous epithelium in patients with azoospermia				Male infertility	INHB
24669628	Male infertility				Male infertility	INHB
21104644	Impaired spermatogenesis			84 (46 men with oligozoospermia, 38 normozoospermic, fertile controls)	Male Infertility	inhibin B FSH
19006797	Male infertility, spermatogenesis				Male infertility	Inhibin B FSH
11275954	Disorders of spermatogenesis			95 (20 proven fertile controls, 15 primary testicular failure, 10 obstructive azoospermia, 10 oligospermia, 40 miscellaneous sperm dysfunction)	Male infertility	Inhibin B activin A follistatin
11275954	Disorders of spermatogenesis			95 (20 proven fertile controls, 15 primary testicular failure, 10 obstructive azoospermia, 10 oligospermia, 40 miscellaneous sperm dysfunction)	Male infertility	Inhibin B activin A follistatin
18154424	Azoospermia, Testicular spermatogenesis			70 patients with male-factor infertility	Male infertility	INHB
17725300	Azoospermia			95 (37 infertile men with obstructive azoospermia, another 33 with non-obstructive azoospermia and 25 normal fertile men as controls)	Male infertility	INHB
16764873	Male factor infertility			87 (75 patients with infertility problems, 12 controls with proven fertility)	Male infertility	INHB
16755869	Nonobstructive azoospermia			70 (40 patients with nonobstructive azoospermia (NOA), 20 patients with obstructive azoospermia (OA), 10 fertile volunteers )	Male infertility	INHB
16483151	Sertoli cell-only syndrome, azoospermia, impaired spermatogenesis			83 (21 Sertoli cell-only syndrome, 20 hypospermatogenesis, 24 maturation arrest, 18 normal spermatogenesis)	Male infertility	INHB
12807515	Cryptorchidism			2773 (2613 subfertile men (161 unilateral cryptorchidism, 102 bilateral cryptorchidism), 64 cryptorchid patients (32 unilateral and 32 bilateral), 128 patients was randomly selected out of the remaining group of 2350 men with idiopathic subfertility, 32 f	Male infertility	INHB
12653784	Varicocele			55 (36 patients with varicocele (Va), 7 non-obstructive azoospermic men (Az), 12 with control group)	Male infertility	FSH LH INHB
19956897	Ovarian endometriosis			18 (13 tissue samples from ovarian endometriosis, 5 premenopausal women without endometriosis)		betaA-subunit of inhibin activin A activin receptors types IA IB IIA IIB Smad2 Smad3 and Smad4
12399529	Azoospermia			70 (10 normozoospermia, 10 men after vasectomy, 50 men with azoospermia)	Male infertility	INHB
9875694	Male subfertility			47 subfertile men	Male infertility	FSH LH INHB
1860676	Male infertility, Azoospermia, Oligozoosppermia				Male infertility	LH FSH Inhibin
11963224	Presence of sperm in azoospermic patients				Male infertility	INHB FSH
12721183	Male infertility, azoospermia, oligozoospermia			28 (11 fertile men, 17 infertile men)	Male infertility	INHB
11695842	Male infertility			39 infertile men	Male infertility	INHB ProalphaC
7659145	Idiopathic infertility, Sertoli cell function, azoospermia, oligozoospermia			125 (21 normal men, 104 men with various testicular disorders resulting in infertility)	Male infertility	INHB FSH
12554256	Oligoazoospermic			72 (52 oligoazoospermic, 20 normospermic men)	Male infertility	INHB
15181071	Male infertility			899 (289 idiopathic infertile men , 303 proven fertile men (reference group 1), 307 healthy men from the general population with unknown fertility status)	Male infertility	inhibin B
12466353	Male gonadal dysfunction, testicular volume			72 (52 oligoazoospermic, 20 normospermic men)	Male infertility	INHB
9619549	Oligozoospermia, Azoospermia			279 (105 fertile men, 174 unselected men attending an infertility clinic)	Male infertility	INHB
15950666	Primary and secondary Sertoli-cell-only (SCO) syndrome, Azoospermia				Male infertility	FSH INHB
20926807	Contributes to establishing the balance between Sertoli and germ cell number that is ultimately required for adult male fertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R