• Gene id: 3623

Gene Summary

• Gene Symbol: INHA   Gene   UCSC   Ensembl
• Gene name: inhibin alpha subunit
• Alternate names: inhibin alpha chain, A-inhibin subunit,
• Gene location: 2q35 (219572231: 219575712)     Exons: 2     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate multiple peptide products, including the alpha subunit of the inhibin A and B protein
• OMIM: 147380

Protein Summary

• Protein general information: P05111  
  • Name: Inhibin alpha chain
  • Length: 366  
  • Mass: 39,670
• Sequence:

  MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPE
  EEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP
  LLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPS
  GGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP
  PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

• Structural information:
  • Interpro: IPR029034  IPR017175  IPR001839  IPR015615  IPR017948  
  • Prosite: PS00250 PS51362
  • DIP: 5826
  • STRING: ENSP00000243786
• Other Databases: GeneCards:  INHA  Malacards:  INHA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001501	skeletal system development	TAS	biological process
GO:0001541	ovarian follicle development	NAS	biological process
GO:0001750	photoreceptor outer segment	IEA	cellular component
GO:0001917	photoreceptor inner segment	IEA	cellular component
GO:0005102	receptor binding	IPI	molecular function
GO:0005125	cytokine activity	TAS	molecular function
GO:0005160	transforming growth factor beta receptor binding	IBA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007399	nervous system development	NAS	biological process
GO:0008083	growth factor activity	TAS	molecular function
GO:0008584	male gonad development	IEA	biological process
GO:0009605	response to external stimulus	TAS	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IBA	biological process
GO:0030154	cell differentiation	TAS	biological process
GO:0030218	erythrocyte differentiation	NAS	biological process
GO:0034673	inhibin-betaglycan-ActRII complex	IDA	cellular component
GO:0034711	inhibin binding	IEA	molecular function
GO:0042127	regulation of cell proliferation	IDA	biological process
GO:0042326	negative regulation of phosphorylation	TAS	biological process
GO:0042541	hemoglobin biosynthetic process	IDA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043408	regulation of MAPK cascade	IBA	biological process
GO:0043512	inhibin A complex	IDA	cellular component
GO:0043513	inhibin B complex	IEA	cellular component
GO:0045077	negative regulation of interferon-gamma biosynthetic process	TAS	biological process
GO:0045578	negative regulation of B cell differentiation	TAS	biological process
GO:0045650	negative regulation of macrophage differentiation	TAS	biological process
GO:0045786	negative regulation of cell cycle	TAS	biological process
GO:0046881	positive regulation of follicle-stimulating hormone secretion	TAS	biological process
GO:0046882	negative regulation of follicle-stimulating hormone secretion	NAS	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0048468	cell development	IBA	biological process
GO:0051726	regulation of cell cycle	IDA	biological process
GO:0060395	SMAD protein signal transduction	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001501	skeletal system development	TAS	biological process
GO:0001541	ovarian follicle development	IEA	biological process
GO:0001541	ovarian follicle development	NAS	biological process
GO:0001750	photoreceptor outer segment	IEA	cellular component
GO:0001917	photoreceptor inner segment	IEA	cellular component
GO:0005102	receptor binding	IPI	molecular function
GO:0005125	cytokine activity	TAS	molecular function
GO:0005160	transforming growth factor beta receptor binding	IBA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007399	nervous system development	NAS	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	TAS	molecular function
GO:0008584	male gonad development	IEA	biological process
GO:0009605	response to external stimulus	TAS	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IBA	biological process
GO:0030154	cell differentiation	TAS	biological process
GO:0030218	erythrocyte differentiation	NAS	biological process
GO:0034673	inhibin-betaglycan-ActRII complex	IDA	cellular component
GO:0034711	inhibin binding	IEA	molecular function
GO:0042127	regulation of cell proliferation	IDA	biological process
GO:0042326	negative regulation of phosphorylation	TAS	biological process
GO:0042541	hemoglobin biosynthetic process	IDA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043408	regulation of MAPK cascade	IBA	biological process
GO:0043512	inhibin A complex	IEA	cellular component
GO:0043512	inhibin A complex	IDA	cellular component
GO:0043513	inhibin B complex	IEA	cellular component
GO:0045077	negative regulation of interferon-gamma biosynthetic process	TAS	biological process
GO:0045578	negative regulation of B cell differentiation	TAS	biological process
GO:0045650	negative regulation of macrophage differentiation	TAS	biological process
GO:0045786	negative regulation of cell cycle	TAS	biological process
GO:0046881	positive regulation of follicle-stimulating hormone secretion	TAS	biological process
GO:0046882	negative regulation of follicle-stimulating hormone secretion	IEA	biological process
GO:0046882	negative regulation of follicle-stimulating hormone secretion	NAS	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0048468	cell development	IBA	biological process
GO:0051726	regulation of cell cycle	IDA	biological process
GO:0060395	SMAD protein signal transduction	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001501	skeletal system development	TAS	biological process
GO:0001541	ovarian follicle development	NAS	biological process
GO:0005102	receptor binding	IPI	molecular function
GO:0005125	cytokine activity	TAS	molecular function
GO:0005160	transforming growth factor beta receptor binding	IBA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007399	nervous system development	NAS	biological process
GO:0008083	growth factor activity	TAS	molecular function
GO:0009605	response to external stimulus	TAS	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IBA	biological process
GO:0030154	cell differentiation	TAS	biological process
GO:0030218	erythrocyte differentiation	NAS	biological process
GO:0034673	inhibin-betaglycan-ActRII complex	IDA	cellular component
GO:0042127	regulation of cell proliferation	IDA	biological process
GO:0042326	negative regulation of phosphorylation	TAS	biological process
GO:0042541	hemoglobin biosynthetic process	IDA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0043408	regulation of MAPK cascade	IBA	biological process
GO:0043512	inhibin A complex	IDA	cellular component
GO:0045077	negative regulation of interferon-gamma biosynthetic process	TAS	biological process
GO:0045578	negative regulation of B cell differentiation	TAS	biological process
GO:0045650	negative regulation of macrophage differentiation	TAS	biological process
GO:0045786	negative regulation of cell cycle	TAS	biological process
GO:0046881	positive regulation of follicle-stimulating hormone secretion	TAS	biological process
GO:0046882	negative regulation of follicle-stimulating hormone secretion	NAS	biological process
GO:0048468	cell development	IBA	biological process
GO:0051726	regulation of cell cycle	IDA	biological process
GO:0060395	SMAD protein signal transduction	IBA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Cancer	GAD: 19574343
Cancer (breast)	GAD: 20634197
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (prostate)	GAD: 19574343
Obesity	GAD: 20734064
Abortion	GAD: 20716560
Endometriosis	INFBASE: 10735596
Female infertility	INFBASE: 10735596
Benign ovarian cysts	INFBASE: 15893868
Deep infiltrating endometriosis	INFBASE: 22416010
Endometrial differentiation	INFBASE: 11425811
Endometrial function	INFBASE: 9886535
Premature ovarian insufficiency (POI)	INFBASE: 24269065
Endometriosis	INFBASE: 21640344
Hypergonadotropic hypogonadism	INFBASE: 9806574
Female infertility	INFBASE: 26405262
Fertilizing defects	INFBASE: 16650414
Female infertility	INFBASE: 7962340
Polycystic ovary syndrome (PCOS)	INFBASE: 20149358
Ovarian endometriosis	INFBASE: 19956897
Ovarian failure	INFBASE: 15205401
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 24455972
MRKH syndrome (congenital uterus and vaginal aplasia)	INFBASE: 19101883
Oocyte quantity	INFBASE: 16650414
Unexplained infertility	INFBASE: 10735596
Unexplained infertility	INFBASE: 10735596
Tubal damage	INFBASE: 10735596
Tubal damage	INFBASE: 10735596
Endometriosis	INFBASE: 10735596
Premature ovarian failure (POF)	KEGG: H00627
Disorders of spermatogenesis	MIK: 11275954
Male factor infertility	MIK: 11275954
Non-normozoospermia	MIK: 25617520
Male factor infertility	MIK: 25617520
Testicular developmental defects	MIK: 26405262
Hypothalamic amenorrhea	INFBASE: 9806574
Female infertility	INFBASE: 9806293
Implantation failure	INFBASE: 20457668
Endometriosis-associated infertility	INFBASE: 20457668
Klinefelter syndrome	INFBASE: 26405262
Associated wih sertoli cell dysfunction	MIK: 20676395
Male infertility	MIK: 20676395
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Non-normozoospermia	MIK: 25617520
Ovarian failure	MIK: 15205401
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25617520	Non-normozoospermia, Male infertility	c.-124G>A, c.-124GG, c.-16C>T		225 (153 non-normozoospermia, 72 normozoospermia)	Male infertility
15205401	Ovarian failure	INHalpha (A257T)		117 (80 patients with POF, 33 patients with primary amenorrhoea, 4 patients with secondary amenorrhoea)
20676395	Associated wih sertoli cell dysfunction, male infertility				Male infertility
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R