• Gene id: 3622

Gene Summary

• Gene Symbol: ING2   Gene   UCSC   Ensembl
• Aliases: ING1L, p33ING2
• Gene name: inhibitor of growth family member 2
• Alternate names: inhibitor of growth protein 2, ING1Lp, inhibitor of growth 1-like protein, p32,
• Gene location: 4q35.1 (183825601: 183815883)     Exons: 3     NC_000003.12
• Gene summary(Entrez): This gene is a member of the inhibitor of growth (ING) family. Members of the ING family associate with and modulate the activity of histone acetyltransferase (HAT) and histone deacetylase (HDAC) complexes and function in DNA repair and apoptosis. Alterna
• OMIM: 604215

Protein Summary

• Protein general information: Q9H160  
  • Name: Inhibitor of growth protein 2 (Inhibitor of growth 1 like protein) (ING1Lp) (p32) (p33ING2)
  • Length: 280  
  • Mass: 32808
  • Tissue specificity: Widely expressed. Higher expressed in colon-cancer tumor than in normal colon tissues. {ECO
• Sequence:

  MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKYKKEDD
  LNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSR
  RPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAIDPNEPTYCLCNQVSYGEM
  IGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR

• Structural information:
  • Interpro: IPR028639  IPR042019  IPR028651  IPR024610  IPR019786   IPR011011  IPR001965  IPR019787  IPR013083  
  • Prosite: PS01359 PS50016
  • CDD: cd15683
  • STRING: ENSP00000307183
• Other Databases: GeneCards:  ING2  Malacards:  ING2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IMP	cellular component
GO:0005886	plasma membrane	IMP	cellular component
GO:0035064	methylated histone binding	IBA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0035064	methylated histone binding	IDA	molecular function
GO:0035091	phosphatidylinositol binding	IDA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:2000772	regulation of cellular senescence	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0040008	regulation of growth	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003682	chromatin binding	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072520	seminiferous tubule development	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:0048133	male germ-line stem cell asymmetric division	IEA	biological process
GO:0031065	positive regulation of histone deacetylation	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0007141	male meiosis I	IEA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007286	spermatid development	ISS	biological process
GO:0072520	seminiferous tubule development	ISS	biological process
GO:2001020	regulation of response to DNA damage stimulus	NAS	biological process
GO:0007141	male meiosis I	ISS	biological process
GO:0031065	positive regulation of histone deacetylation	ISS	biological process
GO:0030317	flagellated sperm motility	ISS	biological process
GO:0048133	male germ-line stem cell asymmetric division	ISS	biological process
GO:1902166	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	TAS	biological process
GO:2000772	regulation of cellular senescence	NAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016602	CCAAT-binding factor complex	IDA	cellular component
GO:0016580	Sin3 complex	IDA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881